KEGG   Bordetella avium: BAV1583Help
Entry
BAV1583           CDS       T00695                                 

Definition
(GenBank) putative dioxygenase system, alpha subunit
  KO
K16319  anthranilate 1,2-dioxygenase large subunit [EC:1.14.12.1]
Organism
bav  Bordetella avium
Pathway
bav00627  Aminobenzoate degradation
bav01100  Metabolic pathways
bav01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bav00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    BAV1583
Enzymes [BR:bav01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.12  With NADH or NADPH as one donor, and incorporation of two atoms of oxygen into the other donor
    1.14.12.1  anthranilate 1,2-dioxygenase (deaminating, decarboxylating)
     BAV1583
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Rieske Ring_hydroxyl_A
Motif
Other DBs
NCBI-ProteinID: CAJ49193
UniProt: Q2L1S3
LinkDB All DBs
Position
1651862..1653151
Genome map
AA seq 429 aa AA seqDB search
MFSTQSVINITPLSKDGSIQDCKWPEDGLHYIPDWVYTNKEVYEREMSCIFRGKTWNYVA
LEAEIPNVGDYKRSYVGDTPVVVSRAEDGSIHVFENRCAHRGAEFCRHSRGNNTEFVCPY
HQWSYDLKGNLQGVPFKRGVNKVGGMPKDFKASEHGLKKLYVTTLNGVVFASYSADVEPI
EEYLQPEIKKDFDVVFNGKKLKILGYYKNELPCNWKMYHENLKDPYHATLLHSFLVVFGL
LVAGNDAAMIADAKHGRHGTMASAKKEDKYAEVSEENKKEMRSFHEGMRLKDERFLDFIK
EFDSPWSVTMQTIWPNMIVQREMNTLGVRHIVPNGPNSMIMMWTMFGYEDDTEEMTQHRL
RQGNLMGPSGFLGLEDNEAMKFVQEGVRRSSSDLNVIKLDADTVGTSKGLISEAAIRAMY
QYYRQEMGF
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atgtttagcactcaatcggttatcaacattaccccgctgtcgaaagacggcagcatccag
gactgcaaatggccggaagacggtctgcactacatccctgattgggtttacaccaacaag
gaagtttacgaacgggagatgagctgtatctttcgcggcaagacctggaactacgtcgcg
ctcgaagcggaaattcccaatgtcggtgactacaagcgctcctatgttggcgatacccct
gtggtcgtctctcgtgccgaggacggcagcatccacgttttcgagaatcgctgtgcgcat
cgcggcgccgaattttgccggcatagccgcggcaacaacaccgagttcgtttgcccttac
caccaatggtcgtatgacctaaaaggcaatttgcagggcgttcctttcaagcggggagtg
aacaaagtcggcggtatgcccaaagacttcaaggcctccgaacatggactcaagaagctg
tatgtcactacgcttaatggtgtggtgttcgcctcttacagtgccgacgtggagcccatc
gaggagtatctgcagccggaaatcaagaaagatttcgatgtggtgttcaacggcaagaag
ctcaagatcctcggttactacaagaacgagttgccctgcaactggaagatgtaccacgag
aatctgaaagatccttaccacgccacgctgctgcactcctttctcgtcgtgttcggcctg
ctggtggcgggcaacgacgccgccatgatcgccgatgcgaaacacggccgtcacggcacg
atggcttctgccaagaaggaggacaagtacgccgaggtgagcgaggaaaacaagaaagaa
atgcgttcattccatgaaggaatgcgcttgaaggacgaacgctttctcgacttcatcaag
gagttcgattctccctggtcggtaaccatgcagacgatctggcccaatatgatcgttcag
cgcgagatgaatacgctgggtgtacgccatatcgtgccgaatggccccaacagcatgatc
atgatgtggaccatgttcggctacgaggatgacaccgaagagatgacccagcaccgtctg
cgtcagggtaatttgatggggccgtcgggcttcctcggtctggaggacaacgaggccatg
aaattcgttcaggagggcgtgcgccgctcaagcagcgacttgaatgtgatcaagctcgat
gcggatacggtcggtacatcgaaggggcttatttctgaggcggccattcgcgcgatgtat
caatactaccgccaagaaatgggcttctaa

DBGET integrated database retrieval system