KEGG   Bordetella avium: BAV2246Help
Entry
BAV2246           CDS       T00695                                 

Gene name
rpiA
Definition
(GenBank) ribose-5-phosphate isomerase
  KO
K01807  ribose 5-phosphate isomerase A [EC:5.3.1.6]
Organism
bav  Bordetella avium
Pathway
bav00030  Pentose phosphate pathway
bav01100  Metabolic pathways
bav01110  Biosynthesis of secondary metabolites
bav01120  Microbial metabolism in diverse environments
bav01130  Biosynthesis of antibiotics
bav01200  Carbon metabolism
bav01230  Biosynthesis of amino acids
Module
bav_M00007  Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
Brite
KEGG Orthology (KO) [BR:bav00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    BAV2246 (rpiA)
Enzymes [BR:bav01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.6  ribose-5-phosphate isomerase
     BAV2246 (rpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Rib_5-P_isom_A
Motif
Other DBs
NCBI-ProteinID: CAJ49856
UniProt: Q2KYQ1
LinkDB All DBs
Position
complement(2423872..2424546)
Genome map
AA seq 224 aa AA seqDB search
MLTQQQLKQQAADAALEFVEQVAGPDVIIGVGTGSTADLFIDGLARFAGRIRGTVASSER
SAQRLASHGLLVLDLNDVQYMPIYVDGADEIDANLHMIKGGGGALTREKIVASVAERFIC
IADESKLVDRLGAFPLPLEVIPMARAAVARSLAALGGEPRLREGFVTDNGNIILDVHGLS
INDAPALEARVNNIPGVVTCGLFSLAGADVALLATQNGIRRLSR
NT seq 675 nt NT seq  +upstreamnt  +downstreamnt
atgcttactcagcaacagctcaaacaacaggctgccgacgcggcgcttgaattcgtggaa
caggtcgccggccccgatgtcatcatcggggtgggcactggctcgaccgccgatctcttc
attgacgggctggcccgtttcgccgggcgcatccgcggcacggtcgccagttcagagcgc
agcgcccagcgcctggcttcgcacggtttgctcgtgctggacctaaacgatgtccagtac
atgccgatttatgtcgacggcgcggacgagatcgatgccaatctgcatatgattaaaggc
ggtggtggcgccctgacccgcgaaaaaatcgtggcgtccgtggccgagcgcttcatctgc
attgcagatgagtccaagcttgtcgatcgcctgggtgcctttccgctgccgctggaggtg
attcccatggctcgcgcagccgtggcgcgcagcttggcggcgttgggcggcgaaccccgt
ctgcgcgaaggtttcgtgaccgataacggcaatatcattcttgacgtgcatggcctgagc
atcaacgatgctcccgcgctggaggcccgcgtgaacaatattccgggcgtggtaacctgc
ggcctgttctcgctggccggcgccgatgttgccttgctcgcaacccagaacggcatccgc
cgtctatcgcgctga

DBGET integrated database retrieval system