KEGG   Bordetella avium: BAV2666Help
Entry
BAV2666           CDS       T00695                                 

Definition
(GenBank) putative amidase
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
bav  Bordetella avium
Pathway
bav00970  Aminoacyl-tRNA biosynthesis
bav01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bav00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    BAV2666
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:bav03029]
    BAV2666
Enzymes [BR:bav01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     BAV2666
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     BAV2666
Mitochondrial biogenesis [BR:bav03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    BAV2666
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-ProteinID: CAJ50277
UniProt: Q2KWI7
LinkDB All DBs
Position
2883094..2884422
Genome map
AA seq 442 aa AA seqDB search
MNTIKALSAALAAGQTTSLQLVENALQRIADYRQQGGAAYTQVDAESALQAAHASDLARR
AGYVPSALAGLPISIKDLFDVQGQVSTAGSRALDGAAPAVQDAPVVARLRQAGAILLGRT
NMSEFAFSGLGLNPHYGTPRAPHDENRIAGGSTSGGAVTVARGMAVAALGTDTGGSIRIP
SAFCGLTGFKPTASRVPRTGAVPLSSSLDSIGPLAASVGCCATFDAIIRGRLDGSAPEAA
SLKGLRLYITRDFVFDNIDPEVEQAFQTYVQNLARHGAILVPFDFPELRELPDINAAGGL
TAAEAWAWHRRLLASEGDRYDPRVAVRIRRGAAISAADYLDVQAARARIQAIARHRLRDA
DGWLMPTVAVQPPLLAPLERDDDTFFATNGLVLRNPSTINFLDGCALSLPTDQAGIGLSV
CGLHGQDARVLSVAAALEATRA
NT seq 1329 nt NT seq  +upstreamnt  +downstreamnt
atgaatacgatcaaggcattgagcgcggcgcttgccgcaggccagaccacaagcttgcaa
ctggtcgagaacgcgctgcaacgtatcgccgactaccgccaacagggcggcgcagcctac
acacaggttgacgccgagtccgccctacaggctgcccacgccagcgatctggcccgacgc
gccggttatgtgcccagcgccttggccggcttgcccatctccatcaaagacttgttcgat
gtgcagggccaggtttccacggcaggctcgcgcgcgctcgacggcgccgcgcccgccgtt
caggatgcgcccgtcgtggcccgcctgcgccaggcgggcgccattctgctgggccgcacc
aatatgagcgaattcgcattttccggcctgggcctgaatccgcactacggcacgccccgc
gcgccccatgacgaaaaccgcatcgcgggcggctcgacttcgggcggcgccgtcactgtc
gcgcgcggcatggccgtggcggcgctaggcaccgacacgggtggatctatccgcattccc
tccgccttctgcggcctgaccggcttcaagccgacggccagccgcgtgccacggaccggc
gccgtcccgctgtctagctcactggattcgatcggccctttggcggcatcggtaggctgc
tgcgccaccttcgatgccatcatccgtggccggctcgacggcagcgcccccgaagcggcc
tcgctaaaaggcttgcgcctgtacatcacccgcgactttgtctttgacaacattgacccg
gaggtcgagcaggcattccagacttacgtccaaaacctcgcccgccatggcgccatcctc
gtgcccttcgattttcccgaattacgcgagctgccggacatcaatgcggccggcggtctg
acggctgcggaagcctgggcctggcaccgcaggctgctggcatccgagggcgaccgttac
gatccgcgcgtggccgtccgcatccgccggggcgcggccatcagcgccgccgactacctg
gatgttcaggctgcccgcgcccgtatccaagctatcgcccgccatcgcctgcgcgacgcg
gacggctggctgatgccgaccgtggccgtgcagccgcctttgcttgccccgctggagcgc
gacgacgacaccttctttgccaccaacggactggtgctgcgcaacccaagcaccatcaat
ttcctggatggctgcgcgctgtctttgccgaccgaccaagccggtatcggtctgtcggtg
tgcggtctgcacggccaggacgctcgcgtgctgagcgttgccgccgcgctcgaagccacg
cgcgcttga

DBGET integrated database retrieval system