KEGG   Bordetella avium: BAV2797Help
Entry
BAV2797           CDS       T00695                                 

Gene name
gadA2
Definition
(GenBank) glutamate decarboxylase alpha/beta
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
bav  Bordetella avium
Pathway
bav00250  Alanine, aspartate and glutamate metabolism
bav00410  beta-Alanine metabolism
bav00430  Taurine and hypotaurine metabolism
bav00650  Butanoate metabolism
bav01100  Metabolic pathways
bav01110  Biosynthesis of secondary metabolites
bav01120  Microbial metabolism in diverse environments
bav02024  Quorum sensing
Module
bav_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:bav00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    BAV2797 (gadA2)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    BAV2797 (gadA2)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    BAV2797 (gadA2)
   00430 Taurine and hypotaurine metabolism
    BAV2797 (gadA2)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    BAV2797 (gadA2)
Enzymes [BR:bav01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     BAV2797 (gadA2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC
Motif
Other DBs
NCBI-ProteinID: CAJ50408
UniProt: Q2KVV2
LinkDB All DBs
Position
3026043..3027443
Genome map
AA seq 466 aa AA seqDB search
MPLHAKHSLRTALLDDVFASDDLAAPLPRHRFPVTQQTAQHAYQAVHDELMLDGNSRQNL
ATFCQTWLDAETHRLMDESIDKNMIDKDEYPQTAELEARCVHMLADLWNAPEAENPTGCS
TIGSSEAAMLGGLAMKWAWRGRRKAAGKPSDQPNLICGPVQICWHKFARYFDVELREIPM
EHGRLIMSPEEVLKRADENTIGVVPTLGVTYTCQYEPVTAVHQALDRLQQETGLDIPMHI
DGASGAFLAPFCAPDLVWDFRLPRVVSINASGHKFGLAPLGVGWVIWRDAKHLPEDLIFN
VNYLGGNMPTFALNFSRPGGQIVAQYYNFLRLGREGYQSIQNACYDTAQYLAREIAALGP
FEILVDGNPAHGIPGLCWKIKDGQKDPGFTLYDMADRLRTRGWQVPAYSLPANRQDLVIQ
RILVRHGVSRDLASLLIDDFKRAMAYFRTHTITTSTADKPANAFHH
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atgccattgcacgcaaagcactctctgcgcaccgccctgctggatgatgtcttcgcttcc
gacgacctcgcggcgccgctgcccagacaccgcttcccggtcacacaacaaaccgcacaa
cacgcttaccaggccgttcatgacgagctgatgctagacggcaattcacgccagaatctg
gccacgttttgtcagacatggctggatgccgaaacgcacagactcatggatgagtcgatc
gacaaaaacatgatcgacaaagatgaatatccgcagacggcggagctggaagcgcgttgt
gtacatatgctggccgacctctggaacgcgcccgaggctgaaaatcccaccggctgctcc
accatcggctcatcggaagccgcaatgctgggcggactggccatgaagtgggcctggcgc
ggcaggcgcaaagccgccgggaaacccagtgatcagcccaatctcatttgcggcccggtg
cagatctgctggcataaattcgcacgctatttcgatgtcgaactgcgcgaaatacccatg
gagcacggtcggctcatcatgagccccgaagaagtgctcaagcgcgctgatgaaaacacc
ataggcgtcgtgcccactctgggtgtcacctacacctgccaatacgagccggtcactgcg
gtgcaccaggcccttgatcgcctgcaacaagaaacaggccttgatattccgatgcatatc
gatggcgcaagcggggcatttctcgcccctttctgcgcgcccgacctggtgtgggatttc
cgcttgccgcgcgtagtgtcgatcaatgcatcaggacataaattcgggctcgccccgctg
ggcgtaggctgggtcatatggcgcgacgccaagcacctgcccgaagacctgatcttcaat
gtgaactacctgggcggcaacatgccgaccttcgcgttgaacttctcgcgtccgggcggc
cagatcgtggcccagtactacaactttctgcgtctgggccgcgagggctatcaaagcatc
cagaacgcctgctacgacactgcgcagtatctcgcccgcgaaattgccgcgctcggccct
ttcgaaattttggtggatggcaatccggcccatggcattcccggcttatgctggaaaatc
aaagatggccagaaagacccgggcttcacgctctatgacatggcagaccgtctgcgcaca
cgcggctggcaggtccccgcctactctctgcccgccaaccgccaagaccttgtcatccag
cgcatcctggtgcggcacggtgtcagccgtgatctggccagcctgctgatcgatgacttc
aagcgtgcgatggcatatttccgcacacacaccatcacgaccagcacggccgacaagccg
gccaatgccttccaccattaa

DBGET integrated database retrieval system