KEGG   Bordetella avium: BAV2938Help
Entry
BAV2938           CDS       T00695                                 

Gene name
fabI
Definition
(GenBank) enoyl-[acyl-carrier-protein] reductase [NADH]
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
bav  Bordetella avium
Pathway
bav00061  Fatty acid biosynthesis
bav00780  Biotin metabolism
bav01100  Metabolic pathways
bav01130  Biosynthesis of antibiotics
bav01212  Fatty acid metabolism
Module
bav_M00083  Fatty acid biosynthesis, elongation
bav_M00572  Pimeloyl-ACP biosynthesis, BioC-BioH pathway, malonyl-ACP => pimeloyl-ACP
Brite
KEGG Orthology (KO) [BR:bav00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    BAV2938 (fabI)
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    BAV2938 (fabI)
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    BAV2938 (fabI)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:bav01004]
    BAV2938 (fabI)
Enzymes [BR:bav01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     BAV2938 (fabI)
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     BAV2938 (fabI)
Lipid biosynthesis proteins [BR:bav01004]
 Fatty acid synthase
  Component type
   BAV2938 (fabI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR Enoyl_reductase
Motif
Other DBs
NCBI-ProteinID: CAJ50548
UniProt: Q2KV51
LinkDB All DBs
Position
3196331..3197116
Genome map
AA seq 261 aa AA seqDB search
MGFLAGKRILVTGVLSNRSIAYGIARACHQQGAELAFTYVGDRFKDRITEFAADFGSDII
LPCDVAEDSQIEGAFAALKERWDGLDGLVHSIGFAPREAIAGDFLDGLSREGFRIAHDIS
AYSFAAMAKAALPLMEGRKASVLTLTYLGAERVVPNYNTMGLAKASLEASVRYLANALGP
RGIRANGISAGPIKTLAASGIKDFSSILKFVEASAPLRRNVTIEDVGNVAAFMLSDLAAG
VTGEITHVDAGFSTIVPGMED
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgggctttctcgctggcaagcgcatcctcgtcaccggggtgctctccaaccgttccatc
gcttacggcatcgctcgcgcctgccatcaacagggcgccgagctggcgttcacctatgtc
ggcgaccgtttcaaagaccgcatcactgaattcgccgccgatttcggcagcgatatcatc
ctgccctgtgacgtcgcggaagacagccagatcgaaggcgcgttcgccgcactcaaggaa
cgctgggacggcctggacggcctggtccactccattggtttcgcaccgcgcgaagccatt
gccggcgactttctcgatggcctgtcgcgcgaaggcttccgcatcgcccatgacatctcg
gcctatagcttcgcggccatggccaaggctgcgctgccgctgatggagggccgcaaggcc
tccgtgctcaccctgacttatctcggcgccgagcgcgtcgtccccaactacaacaccatg
gggctggccaaggcctctctggaagccagcgtgcgctatctggccaatgcgctgggtccg
cgcggcatccgtgccaacggcatttccgccggcccgatcaagacgctggcggccagcggc
atcaaggacttctcgtccattctgaaatttgtcgaagccagcgcaccgctgcgtcgcaac
gtcacgatcgaagacgtcggcaatgtggcggccttcatgctgtcggatctagctgcgggc
gtcaccggcgagatcacccatgtcgatgcgggtttttcgaccatcgtgcctggcatggaa
gactga

DBGET integrated database retrieval system