KEGG   Bordetella avium: BAV3422Help
Entry
BAV3422           CDS       T00695                                 

Gene name
maeB2
Definition
(GenBank) NADP-dependent malic enzyme
  KO
K00029  malate dehydrogenase (oxaloacetate-decarboxylating)(NADP+) [EC:1.1.1.40]
Organism
bav  Bordetella avium
Pathway
bav00620  Pyruvate metabolism
bav01100  Metabolic pathways
bav01120  Microbial metabolism in diverse environments
bav01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bav00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BAV3422 (maeB2)
Enzymes [BR:bav01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.40  malate dehydrogenase (oxaloacetate-decarboxylating) (NADP+)
     BAV3422 (maeB2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PTA_PTB malic Malic_M Malate_DH
Motif
Other DBs
NCBI-ProteinID: CAJ51032
UniProt: Q2KTH9
LinkDB All DBs
Position
3723726..3726020
Genome map
AA seq 764 aa AA seqDB search
MPQNPNDRQAALDYHEFPTPGKIAVTASKPLVTQRDLALAYSPGVAAACEEIVDDPANAF
RYTGRGNLVGVISNGTAVLGLGNIGALASKPVMEGKAVLFKKFAGLDVFDIEINETDPDK
LVEIIAGLEPTFGGINLEDIKAPECFTVERKLRERMKIPVFHDDQHGTAITVSAAFINGL
KVVGKDIKQVKVVTSGAGAAALACLDLMVDLGLPLENIWVTDIEGVVYEGRVALMDPDKA
RFAQKTDARKLADVIADADVFLGLSAGGVLKPEMVAAMAPRPLILALANPTPEILPEVAN
SVRDDIVMATGRSDYPNQVNNVLCFPYIFRGALDIGATTITREMEKAAVYAIAGLAEEEA
NEVVAAAYGSYDLSFGPNYLIPKPFDPRLIVRIAPAVARAAMAEGVATRPIADLDAYVEQ
LQQFVYHSGAFMKPLFAIAKQVVRDQGRARIVFTEGEDERVLRAVQVIVDEKLAKPILVG
RPAVLLSRIEKFGLRLRLGQDVEVTNPEYDERFHQYWTTYWELMNRRGITKEMARVEMRR
RMTLIGAMMVRLGDADGMICGAVGAYHDHLRFVDEVLGKKPGANTYAAMNILLLDQRTVA
LVDTHVNEDPTAQQISEFTLAAAEEMKRLNLAPKVALLSRSNFGSGSSTSGGKMRAALEL
IREQAPELEIDGEMHGDCALDEALRLRILPSSTLRGSANLLVCPNVDSGNIAYNLLKTAA
GGNVAVGPFLLGANAPVNILTSSSTVRRIINMTALTVIEANRRD
NT seq 2295 nt NT seq  +upstreamnt  +downstreamnt
atgccccagaatcccaatgaccgtcaggcagcactggactaccacgagtttccgaccccc
ggaaaaatcgccgtcacggcatccaaacccctggtgacgcaacgcgatctggcgctggcc
tattcgcccggcgtggcggcggcctgtgaagaaatcgtcgacgatcccgccaacgccttt
cgctacaccgggcgcggcaatctggtgggcgtgatctccaacggcacggctgtgctaggt
ctgggcaatatcggcgcgttggcctccaagcccgtgatggagggcaaggccgtactgttc
aagaagttcgctggcctggacgtgttcgatatcgaaatcaacgagaccgaccctgacaag
ctggtcgagatcatcgccggcctggagcccaccttcggcggcatcaacctcgaagacatc
aaggcgcccgagtgcttcacggtcgagcgcaagctgcgcgagcgcatgaagattcccgtc
ttccatgacgatcagcatggcaccgccattaccgtcagcgccgccttcatcaacggcctg
aaggtcgtgggcaaggacatcaagcaggtcaaggtcgtgacctcgggcgccggcgcggcc
gcactggcctgcctggacctgatggtggacctgggcctgccgctggaaaacatctgggtg
accgatatcgagggtgtggtttacgaaggccgtgtcgcgctgatggacccggacaaggcc
cgttttgcgcaaaaaaccgacgcgcgcaagctggctgatgtcatcgctgacgcggatgtg
ttcctgggcctgtcggccggcggcgtgctcaaacccgaaatggtcgccgcgatggcgccg
cgccccctgattctggccctggccaatcccacgccggaaatcctgcccgaagtcgcaaat
agcgtgcgtgacgatatcgtcatggccacgggccgttcggactatcccaaccaggtcaac
aacgtcctgtgtttcccctacatcttccgcggcgcgctggacatcggcgccaccacgatc
acgcgtgagatggaaaaagccgcggtttacgccatcgctggcctcgctgaagaagaggcc
aatgaagtcgtggcagccgcctatggcagttacgatctgtctttcggtccgaattacctg
attcccaagccctttgatccgcgcctgatcgtgcgcatcgcgccggccgtggcccgcgcg
gcgatggccgaaggcgtggccacccgcccgattgccgatctggacgcctacgtcgaacag
ttgcagcaattcgtctaccactccggcgctttcatgaaacccctgttcgccatcgccaaa
caggtcgtgcgtgaccagggccgcgcgcgcatcgtgttcacggaaggcgaagatgaacgc
gtgctgcgtgccgtgcaagtcatcgtggacgaaaaactcgccaaaccgattctggtcggc
cgtccggccgtgctgctttcccgcatcgagaaattcggcctgcgcctgcgcctgggtcag
gacgtcgaggtcactaatccggaatacgacgaacgcttccatcaatactggacgacctac
tgggagctgatgaaccgtcgtggcatcaccaaggaaatggcgcgtgtggagatgcgccgc
cgcatgacgctgatcggcgccatgatggtgcgcctgggcgatgcggatggcatgatttgc
ggcgcagtaggggcctatcacgaccatttgcgattcgtggatgaagtgctgggcaaaaaa
cccggcgccaacacctacgccgcaatgaacatccttttgttggatcaacgtaccgtcgca
ttggtagacacccacgtcaacgaagaccccacggcgcaacagatctccgagttcacgctg
gcagccgccgaagaaatgaagcgcctgaatctggcgccgaaagtggcgttgctgtcgcgc
tctaatttcggttcgggcagttccacctccggcggcaaaatgcgcgctgcgctggaactg
atccgcgaacaagcacccgaattagagatcgacggagaaatgcacggagattgcgcgctg
gatgaggccctgcgcctgcgcatactgccctcatcaacgttgcgcggctctgccaatctg
ctggtctgccccaacgtggactctggcaatatcgcctacaacctgctcaagacggccgca
ggcggtaatgtggccgtcggtcctttcctgctgggcgccaacgctcccgtcaatatcctg
acgtccagctcgaccgtacgccgcatcatcaacatgacagcgctgacggtcatcgaagcc
aatcgacgcgactaa

DBGET integrated database retrieval system