KEGG   Buchnera aphidicola JF98 (Acyrthosiphon pisum): CWU_00390
Entry
CWU_00390         CDS       T01826                                 
Name
(GenBank) cysteine synthase A
  KO
K01738  cysteine synthase [EC:2.5.1.47]
Organism
baw  Buchnera aphidicola JF98 (Acyrthosiphon pisum)
Pathway
baw00270  Cysteine and methionine metabolism
baw00920  Sulfur metabolism
baw01100  Metabolic pathways
baw01110  Biosynthesis of secondary metabolites
baw01120  Microbial metabolism in diverse environments
baw01200  Carbon metabolism
baw01230  Biosynthesis of amino acids
Module
baw_M00021  Cysteine biosynthesis, serine => cysteine
Brite
KEGG Orthology (KO) [BR:baw00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    CWU_00390
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    CWU_00390
Enzymes [BR:baw01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.47  cysteine synthase
     CWU_00390
SSDB
Motif
Pfam: PALP PG_isomerase_N Glyco_hydro_8
Other DBs
NCBI-ProteinID: ADP67620
LinkDB
Position
complement(71251..72198)
AA seq 315 aa
MSKIYQDNSLTIGNTPLVRLNRIGNGNILVKIESRNPSFSVKCRIGANMIWHAEKNNNIN
KNVKLIEATSGNTGIALAYVAASRNYRLTLTMPETMSIERKKILKSLGAELILTDGRYGM
KGAISKANDIISRNPSKYFLLKQFENPANPEIHQITTGPEIWNDTNGNLDILISAVGTGG
TITGITRYIKKIKRKKNLISIAVEPSESPVITQFLAGKAIEPGPHKIQGIGPGFIPKNLD
LTIIDQVITVSSEEAILTAKELMKKEGILAGISSGAALYAAIKIQQQKKFSDKKIVVILP
SSGERYLSTELFSEL
NT seq 948 nt   +upstreamnt  +downstreamnt
atgagtaaaatatatcaagataattctttaactattggtaatacacctctagttcgttta
aatagaattggaaatggaaatattttagtgaaaatagaatctagaaatccaagttttagt
gttaaatgtagaattggtgctaatatgatatggcacgccgaaaaaaataataatataaat
aaaaatgtaaaactaatcgaggcgactagtggtaatacaggaatagcattagcttatgtt
gcagcttctagaaattatcgattaactctaactatgcctgaaaccatgtctattgagcgg
aaaaaaatattaaaatctttaggtgcagaattgattttaaccgatggaagatatggcatg
aagggagctatttccaaggcaaatgatattatatctcgcaatccaagtaaatatttttta
ttaaaacaatttgagaatccagctaatcctgaaattcatcaaattactactggaccagaa
atatggaacgatactaatggcaatttagatattttaatttctgctgtaggaacgggtggc
acaattactggtatcacaagatatatcaaaaaaataaaaagaaaaaaaaatttaatcagt
atagctgttgaaccttctgaatcacctgtaatcacacaatttttagcaggaaaagcaatc
gagcctggaccacataaaattcaaggaattgggcctggttttatacccaaaaacttagat
ttaacaataatcgatcaagttattactgtttctagtgaagaagcaatattaacggctaaa
gaattaatgaaaaaagaaggtatactagcaggaatctcttctggtgctgcgttatatgca
gcaataaaaatccaacagcaaaaaaaattttcagacaaaaaaatagttgttattttacct
tcttcaggagaacgttatttaagtacagaattattttctgaactataa

DBGET integrated database retrieval system