KEGG   Bacillus anthracis H9401: H9401_1158Help
Entry
H9401_1158        CDS       T02028                                 

Definition
(GenBank) Enoyl-(acyl-carrier-protein) reductase
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
bax  Bacillus anthracis H9401
Pathway
bax00061  Fatty acid biosynthesis
bax00780  Biotin metabolism
bax01100  Metabolic pathways
bax01130  Biosynthesis of antibiotics
bax01212  Fatty acid metabolism
Module
bax_M00083  Fatty acid biosynthesis, elongation
bax_M00572  Pimeloyl-ACP biosynthesis, BioC-BioH pathway, malonyl-ACP => pimeloyl-ACP
Brite
KEGG Orthology (KO) [BR:bax00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    H9401_1158
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    H9401_1158
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    H9401_1158
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:bax01004]
    H9401_1158
Enzymes [BR:bax01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     H9401_1158
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     H9401_1158
Lipid biosynthesis proteins [BR:bax01004]
 Fatty acid synthase
  Component type
   H9401_1158
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR Enoyl_reductase
Motif
Other DBs
NCBI-ProteinID: AFH82544
LinkDB All DBs
Structure
PDB: 

Position
1181148..1181918
Genome map
AA seq 256 aa AA seqDB search
MELLQGKTFVVMGVANQRSIAWGIARSLHNAGAKLIFTYAGERLERNVRELADTLEGQES
LVLPCDVTNDEELTACFETIKQEVGTIHGVAHCIAFANRDDLKGEFVDTSRDGFLLAQNI
SAFSLTAVAREAKKVMTEGGNILTLTYLGGERVVKNYNVMGVAKASLEASVKYLANDLGQ
HGIRVNAISAGPIRTLSAKGVGDFNSILREIEERAPLRRTTTQEEVGDTAVFLFSDLARG
VTGENIHVDSGYHILG
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atggaactattacaagggaaaacatttgttgttatgggcgttgcgaaccaaagaagtatt
gcatggggaattgctcgctctttgcataatgcaggtgcaaaattaatcttcacatatgca
ggagaacgtttagagagaaatgttcgtgaattagcggatacattagaaggacaagaatca
cttgtattaccttgtgatgtaacaaatgatgaagaacttacagcttgttttgaaacaatt
aagcaagaagttggtacaattcacggtgttgcacactgtattgcttttgcaaatcgtgac
gacttaaaaggtgaatttgtagatacttctcgcgatggatttttacttgcacaaaatatt
agtgcattctctttaacagctgtagcaagagaagcgaagaaagtaatgacagaaggcgga
aatattttaacgttaacatatcttggcggcgagcgcgttgtgaaaaactataacgttatg
ggtgttgcgaaagcttcattagaagcgagcgtgaaatatttagctaacgatttaggccaa
cacggcattcgcgttaacgctatttctgcaggtccaattcgtacgttatctgccaaaggt
gtaggcgactttaactcaatcttaagagaaattgaggagcgcgcaccacttcgtcgtaca
acaacgcaagaagaagttggggatacagcagtattcttattcagtgatttagcacgcggc
gtaacaggagaaaacattcacgttgattcagggtatcatatcttaggataa

DBGET integrated database retrieval system