KEGG   Bacillus anthracis H9401: H9401_2700Help
Entry
H9401_2700        CDS       T02028                                 

Definition
(GenBank) Aldehyde dehydrogenase (NAD) family protein
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
bax  Bacillus anthracis H9401
Pathway
bax00010  Glycolysis / Gluconeogenesis
bax00053  Ascorbate and aldarate metabolism
bax00071  Fatty acid degradation
bax00280  Valine, leucine and isoleucine degradation
bax00310  Lysine degradation
bax00330  Arginine and proline metabolism
bax00340  Histidine metabolism
bax00380  Tryptophan metabolism
bax00410  beta-Alanine metabolism
bax00561  Glycerolipid metabolism
bax00620  Pyruvate metabolism
bax00625  Chloroalkane and chloroalkene degradation
bax01100  Metabolic pathways
bax01110  Biosynthesis of secondary metabolites
bax01120  Microbial metabolism in diverse environments
bax01130  Biosynthesis of antibiotics
Module
bax_M00135  GABA biosynthesis, eukaryotes, putrescine => GABA
Brite
KEGG Orthology (KO) [BR:bax00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    H9401_2700
   00053 Ascorbate and aldarate metabolism
    H9401_2700
   00620 Pyruvate metabolism
    H9401_2700
  09103 Lipid metabolism
   00071 Fatty acid degradation
    H9401_2700
   00561 Glycerolipid metabolism
    H9401_2700
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    H9401_2700
   00310 Lysine degradation
    H9401_2700
   00330 Arginine and proline metabolism
    H9401_2700
   00340 Histidine metabolism
    H9401_2700
   00380 Tryptophan metabolism
    H9401_2700
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    H9401_2700
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    H9401_2700
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    H9401_2700
Enzymes [BR:bax01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     H9401_2700
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: AFH84086
LinkDB All DBs
Position
complement(2617109..2618593)
Genome map
AA seq 494 aa AA seqDB search
MLTTNIELKPKVKAFLDEEIKMFINGEFVPSISGKTFETYNPATEDVLAVVYEAQEEDID
VAVKAARSAFESGPWVEMTTAERAHLIYKLADLIEEHGEELAQLEALDNGKPYQVALDDD
IAATVENYRYYAGWATKIIGQTIPISKDYLNYTRHEPVGVVGQIIPWNFPLVMSSWKMGA
ALATGCTIVLKPAEQTPLSLLYTAKLFKEAGFPNGVVNFVPGFGPEAGAAIVNHHDIDKV
AFTGSTVTGKYIMRQSAETIKHVTLELGGKSPNIILEDADLEEAINGAFQGIMYNHGQNC
SAGSRVFVHRKHYETVVNELVKMANNVKLGAGMEKDTEMGPLVSKKQQERVLHYIEQGKA
EGATVAAGGERAFEKGYFVQPTVFTDVTDDMTIVKEEIFGPVVVVLPFDSTEEVIERANR
SSYGLAAGVWTQNIKTGHQVANKLKAGTVWINDYNLENAAAPFGGFKQSGIGRELGSYAL
DNYTEVKSVWVNIK
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atgttaacgacaaatattgagttgaaaccaaaagtgaaagcgtttttagatgaagagatt
aaaatgtttattaatggtgaatttgttccttctattagtggaaagacgtttgaaacatat
aatccagcaacagaagatgttcttgcagttgtttatgaagcacaagaagaggatattgat
gtggcagtaaaagcggcgagatctgcatttgaatcaggaccttgggtggaaatgactact
gctgaaagagcacatcttatttataaattagcagacttaattgaagagcatggagaagaa
ttagcacagctagaagctttagataatggaaaaccatatcaagtagcacttgatgatgat
attgcagcgactgtagaaaattatcgctattatgcaggatgggctacaaaaattatcggg
caaaccattccgatttcaaaagattacttaaattacacacgccatgaacctgttggcgtt
gtagggcaaattattccttggaattttccgctcgttatgtcttcttggaaaatgggagct
gcgctagcaacaggttgtacgatcgtattaaaaccagcagaacaaactcctttatcttta
ttatatacagcgaagctctttaaagaggctggttttccaaacggtgttgtaaactttgtt
ccagggtttggtcctgaagcaggagctgcaattgtaaaccatcatgatattgataaagta
gcctttacgggttcaacagttactggaaaatatattatgcgtcaatctgcagaaacaatt
aaacatgtaacgttagaactgggtggtaaatcaccaaatatcattttagaagacgctgat
ttagaagaagcgattaacggtgcattccaaggtattatgtataatcacggtcaaaattgt
agtgctggatctcgcgtgttcgttcaccgaaaacattacgaaacagtcgtaaatgaactt
gtgaaaatggcgaataacgtgaaacttggagcaggtatggagaaggacacggaaatgggt
ccactcgtatctaaaaagcaacaagagcgtgtgctacattacattgaacaaggaaaagct
gaaggcgctactgttgctgctggtggtgaacgtgcatttgaaaaaggttattttgtacag
ccaacagtattcacagatgttacggacgatatgacgatagttaaggaagaaatcttcggt
cctgttgtcgttgtacttccatttgattcgacggaagaagtaattgaaagagcaaatcgt
tcgtcatatggacttgcagcgggcgtatggacacaaaatattaaaacaggacatcaagtt
gccaataagttaaaggcaggaacagtatggattaatgattataacttagaaaatgcagcg
gcaccatttggtgggtttaaacaatctggtatcggccgtgagttaggttcatatgcactt
gataattacacagaagtgaaaagtgtttgggtaaatataaagtaa

DBGET integrated database retrieval system