KEGG   Bacillus velezensis FZB42: RBAM_003850Help
Entry
RBAM_003850       CDS       T00582                                 

Gene name
yclG
Definition
(GenBank) YclG
Organism
bay  Bacillus velezensis FZB42
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_helix NosD Pectate_lyase_3 DUF1565
Motif
Other DBs
NCBI-ProteinID: ABS72784
UniProt: A7Z1A8
LinkDB All DBs
Position
382547..384292
Genome map
AA seq 581 aa AA seqDB search
MPNRILDITDCGVAADGKTDVTGAINQCLAKAVSEGNHTVFFPPGTYKINGTLGGDSSQP
FRNAGINVPSHLTIVLDPECTIKVAPNSSWGYSAFYIGRRENVTITGGRIIGERDEHTYT
NVPLRSTHEWGFGICIEGSSNVLIENVKISDFTGDGIIVSPLGLKTNSDYETSEQVTLRR
CEIRQSRRNNISITGCNTVTVEECVIEDAGQGNGTAPKFGIDIESYGEGDIDYEEALHIT
VRNNFFSGNAASSVTNFNGYNVLIEGNHSDNTISYGYGAHTVISGNVFFRSDGGSRTAVA
GQGVSQGQDSSNAVISNNMITGFSTGIDVRGKSVLVTHNKISQFENTGISVYQAEDVTVD
GNVIENGRSETRRSTGMRATLSENAVFMNNTLNQVTDGISMSAGNITVKQNVLTSFSRGI
WVTGGNAVIEGNTLIPNAYQGAAESYAVSVTNDARAVIKGNLFKSYKNYPIFSSTSSGTS
VISNRFESSPLIVTVYLNSGTHEVIDNTLTINRTAGSPIGIYLNGTSNSLVSGNTINNLS
AASASAIQTNSSASTKIIGNRIIRGVIVKHATDTDSGNIVI
NT seq 1746 nt NT seq  +upstreamnt  +downstreamnt
ttgccgaatcgtatattggatattacggattgcggtgtggcggcagacggaaaaaccgat
gtgacgggcgccatcaaccaatgcttggccaaggccgtcagcgaaggcaatcatacggtg
ttttttccgcccggaacgtataaaatcaacggcacgcttggcggggacagcagccagccg
tttcggaacgccgggattaacgtgccgagccatctcaccatcgttttagatccggaatgc
acgattaaagtggcgccgaacagctcctggggctactcggctttctatataggcaggcgg
gaaaatgtcaccatcaccggcggccggatcatcggcgaacgggatgaacacacgtatacc
aatgtccctttgcgttcgacccatgaatgggggtttggaatctgtattgaaggcagcagc
aatgtgctgatcgaaaatgtgaagatttcggattttacgggagacggcattattgtcagc
ccgctcgggttaaaaacaaacagtgattacgaaacttcagaacaggtgaccctccgccgc
tgtgagatcaggcagtcaaggcgaaacaacatttcaatcaccggctgcaataccgttacg
gtggaagaatgcgtgattgaagacgccgggcaagggaacggaacggctccgaaattcgga
atcgatattgaatcgtacggagaaggcgatattgattatgaagaagctcttcatattacg
gtacgcaacaacttcttttccggaaacgccgcaagctcagtcaccaattttaacggatat
aatgtgttaattgaaggaaatcattccgataacacaatcagctacgggtatggggcacat
accgtcatttcggggaatgtcttctttcggtcagacggcggctcaaggaccgcagtcgcc
ggacaaggtgtgtcacaaggacaggacagcagcaatgccgtcatttccaacaatatgatt
accggtttttccaccggaatagatgtaaggggaaaaagcgtcctcgtcacccataacaaa
atcagtcaatttgaaaatacgggcatttccgtctatcaggcagaagatgtgaccgttgac
ggcaatgtcattgaaaacggacgttccgaaacgagacgaagcactgggatgcgggcgacg
ctgtcggaaaacgccgtctttatgaataatactctgaatcaggtaacggacggaatcagc
atgtcggccggcaatatcaccgtaaaacaaaatgtgctgacatcgttcagccggggcata
tgggtcacaggcggaaatgccgttattgaaggaaatacgctgattccgaatgcgtatcag
ggcgccgcggagtcctatgccgtatctgtgacaaatgacgccagggctgtcatcaaggga
aatctcttcaaaagctacaaaaactatcccattttcagttcaacatcctcgggaacctct
gtcatcagcaaccgctttgaatcatcaccgcttatcgttaccgtgtatctgaattcaggc
acgcatgaagtcatagacaatacgctcacgatcaaccgaacggcgggcagcccgatcggc
atctatctgaacggaacctccaattccctcgtgtcgggcaataccatcaacaacctttcc
gccgcttctgcttccgccatccaaaccaattcctccgcaagtactaaaatcatcggcaac
cgcattatcagaggcgtcattgtgaaacacgcgacagatacggacagcggaaatatcgtc
atctga

DBGET integrated database retrieval system