KEGG   Bacillus velezensis FZB42: RBAM_009370Help
Entry
RBAM_009370       CDS       T00582                                 

Definition
(GenBank) cold-shock protein
  KO
K03704  cold shock protein
Organism
bay  Bacillus velezensis FZB42
Brite
KEGG Orthology (KO) [BR:bay00001]
 09190 Not Included in Pathway or Brite
  09192 Unclassified: genetic information processing
   99973 Transcription
    RBAM_009370
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CSD OB_RNB
Motif
Other DBs
NCBI-ProteinID: ABS73301
UniProt: A7Z2S5
LinkDB All DBs
Position
complement(914548..914748)
Genome map
AA seq 66 aa AA seqDB search
MLEGKVKWFNSEKGFGFIEVEGQDDVFVHFSAIQGEGFKTLEEGQSVSFEIVEGNRGPQA
ANVTKA
NT seq 201 nt NT seq  +upstreamnt  +downstreamnt
atgttagaaggtaaagtaaaatggttcaactctgaaaaaggattcggattcatcgaagta
gaaggtcaagacgatgtattcgttcacttctctgctattcaaggcgaaggcttcaaaact
ttagaagaaggccaatctgtttctttcgaaatcgttgaaggaaaccgcggaccacaagct
gctaacgtaacaaaagcataa

DBGET integrated database retrieval system