KEGG   Bacillus velezensis FZB42: RBAM_011360Help
Entry
RBAM_011360       CDS       T00582                                 

Definition
(GenBank) ABC transporter ATP-binding protein
  KO
K02031  peptide/nickel transport system ATP-binding protein
Organism
bay  Bacillus velezensis FZB42
Pathway
bay02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:bay00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    RBAM_011360
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bay02000]
    RBAM_011360
Transporters [BR:bay02000]
 ABC transporters, prokaryotic type
  Peptide and nickel transporters
   Peptides/nickel transporter
    RBAM_011360
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran oligo_HPY SMC_N AAA_21 AAA_25 AAA_29 TniB AAA_7
Motif
Other DBs
NCBI-ProteinID: ABS73500
UniProt: A7Z3C4
LinkDB All DBs
Position
1112356..1113342
Genome map
AA seq 328 aa AA seqDB search
MSTLLEVNNLKTYFFRKKQPIPAVDGVDFHINKGETVALVGESGSGKSITSLSIMGLVQS
SGGKIMDGSIKLEGRDLASFTENEYCKIRGNDVSMIFQEPMTSLNPVLTIGEQITEVLEY
HKKMNKREASKKAVELLELVGFSRAEQVMKEYPHRLSGGMRQRVMIAIALSCNPKLLIAD
EPTTALDVTIQAQVLELMKDLCKKFDTSILLITHDLGVVSEAADRVIVMYCGQVVESASV
EDLFLNPLHPYTEGLLNSIPVIDGEIDTLKAIKGSVPTPDNLPEGCRFAPRCSKAMDKCK
TGQPELITHESGRSVRCFLYEEEGAQSK
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atgagcacactattagaagtgaataatttaaagacctattttttcagaaagaaacagccg
atccccgcagtcgacggggttgattttcacattaacaaaggcgaaaccgtcgctcttgta
ggagaatccggctcgggcaaaagcatcacctcgctttctattatgggacttgtccaaagc
tcgggcggaaaaattatggacggctcgattaagcttgaaggcagggacctggcctccttc
accgaaaacgaatattgcaaaatccgcggaaatgacgtctctatgatctttcaggagccc
atgacttccctgaacccggtgctgaccatcggcgaacaaattaccgaagtgcttgaatac
cataaaaaaatgaataaaagagaagcgtccaaaaaagccgttgagcttctggaactcgtc
ggattctccagagcggaacaagtaatgaaagaatatccgcaccgtctttccggagggatg
agacagagggtgatgatcgccatcgcgctcagctgcaatccgaagcttctgatcgctgat
gagccgacgacggcgcttgatgtgacgatacaagcccaagtattggagctgatgaaagac
ctctgcaaaaaattcgatacttccattctgctgatcactcacgatttaggtgtggtttcc
gaagccgccgacagggtgatcgtgatgtactgcggacaagtcgtagagagcgcgagtgtg
gaggacttatttttaaaccctcttcatccgtataccgaggggctgttaaactccataccg
gtgatagatggagagattgatacattaaaagcgatcaaaggcagtgtcccgacaccggat
aatcttccggaaggctgccgattcgccccgaggtgttcaaaagcgatggacaaatgcaaa
acagggcagccggagctgataacgcatgaaagcggccgttctgtaagatgttttttatat
gaggaagagggtgcccaatcaaaatga

DBGET integrated database retrieval system