KEGG   Bacillus velezensis FZB42: RBAM_024850Help
Entry
RBAM_024850       CDS       T00582                                 

Gene name
ruvA
Definition
(GenBank) RuvA
  KO
K03550  holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
bay  Bacillus velezensis FZB42
Pathway
bay03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:bay00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    RBAM_024850 (ruvA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:bay03400]
    RBAM_024850 (ruvA)
Enzymes [BR:bay01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     RBAM_024850 (ruvA)
DNA repair and recombination proteins [BR:bay03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     RBAM_024850 (ruvA)
    RecFOR pathway proteins
     RBAM_024850 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuvA_N HHH_5 RuvA_C HHH WIYLD IMS_HHH UBA_6
Motif
Other DBs
NCBI-ProteinID: ABS74845
UniProt: A7Z769
LinkDB All DBs
Position
complement(2606746..2607351)
Genome map
AA seq 201 aa AA seqDB search
MIEFVKGTIDYVSPQYIVIENGGIGYQVFTPNPFIYKVSNQETIFTYHHIKEDAFSLYGF
STREEKALFTKLLNVTGIGPKGALAILGSGDPGAVIEAIEQEDEAFLVKFPGVGKKTARQ
IILDLKGKLADVVPEMIDNLFNHEARIEKQEAETALDEALEALRVLGYAEKEIKKVLPHL
KEETALSTDQYVKKALQKLLK
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
gtgattgaattcgtgaaggggacgattgattatgtatctccccaatacatcgtgattgaa
aacggcggaatcggctatcaggtcttcactccgaatccgtttatttataaggtaagcaat
caagagaccatttttacgtatcatcatataaaagaagatgccttttctttgtacggtttt
tcaacccgggaagaaaaagcgcttttcacaaagctgctgaacgtcaccggcatcgggccg
aaaggggcgctcgccatcctcggttccggtgatcccggagccgtcatcgaagcgatcgaa
caggaagatgaagcctttttggtgaaatttccgggtgtgggcaaaaaaacggcgcggcag
attattcttgatttgaaaggcaaactggccgacgtcgtgcctgaaatgattgacaacctg
ttcaatcatgaagcgcgcattgaaaaacaagaggctgaaacggcgcttgacgaggcgctt
gaagcgctccgggttctcggctacgccgaaaaagaaattaaaaaagtgcttcctcactta
aaagaggaaacggcgctttcaacagatcaatatgtgaaaaaagcattgcaaaaattatta
aagtaa

DBGET integrated database retrieval system