KEGG   Bacillus velezensis FZB42: RBAM_026170Help
Entry
RBAM_026170       CDS       T00582                                 

Gene name
icd
Definition
(GenBank) Icd
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
bay  Bacillus velezensis FZB42
Pathway
bay00020  Citrate cycle (TCA cycle)
bay00480  Glutathione metabolism
bay01100  Metabolic pathways
bay01110  Biosynthesis of secondary metabolites
bay01120  Microbial metabolism in diverse environments
bay01130  Biosynthesis of antibiotics
bay01200  Carbon metabolism
bay01210  2-Oxocarboxylic acid metabolism
bay01230  Biosynthesis of amino acids
Module
bay_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bay_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:bay00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    RBAM_026170 (icd)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    RBAM_026170 (icd)
Enzymes [BR:bay01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     RBAM_026170 (icd)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-ProteinID: ABS74975
UniProt: A7Z7J9
LinkDB All DBs
Position
complement(2742393..2743664)
Genome map
AA seq 423 aa AA seqDB search
MSQGEKITVSNGVLNVPNNPIIPFIEGDGTGPDIWNAASKVLEAAVEKAYKGEKKITWKE
VYAGEKAYNKTGEWLPAETLEDIREYFIAIKGPLTTPVGGGIRSLNVALRQELDLFTCLR
PVRYFTGVPSPVKRPEDTDMVIFRENTEDIYAGIEYAKGSEEVEKLISFLQNEMGVNKIR
FPETSGIGIKPVSEEGTSRLVRAAIEYAIENGRKSVTLVHKGNIMKFTEGAFKNWGYELA
EREYGDKVFTWAEYDRIVEKDGKEAADKAQSDAEAAGKIIVKDSIADIFLQQILTRPSEF
DVVATMNLNGDYISDALAAQVGGIGIAPGANINYETGHAIFEATHGTAPKYAGLDKVNPS
SVILSGVLLLEHLNWNEAADLIIKSMEKTIASKVVTYDFARLMDGATEVKCSEFGEELIK
NMD
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
gtgtcacaaggtgaaaaaattacagtctctaatggagtattaaacgtaccaaataatccg
attatcccgtttattgaaggcgacggcacaggccctgatatttggaacgccgcttctaaa
gtattggaagccgctgttgaaaaagcatataaaggcgagaaaaaaatcacgtggaaagaa
gtttatgccggtgaaaaggcttataataaaacaggtgagtggcttcctgccgaaacgctg
gaagacatcagagagtacttcatcgccatcaaaggtcctctgacgacaccggtcggcggc
ggtatccgttctctgaacgtggcgctgagacaggagcttgatttgtttacgtgcctgcgc
cctgtcagatatttcacgggagtgccttctccggtcaaacgacctgaagatacggatatg
gtcattttccgcgagaatacggaagatatttacgccggaattgagtatgcgaaaggttct
gaagaggttgaaaagctgatcagcttcctgcaaaatgaaatgggtgttaacaaaatccgt
ttccctgaaacgtcaggaatcggcatcaaacctgtttctgaagaaggcacaagccgctta
gtcagagctgccattgagtatgcgatcgaaaacggccgtaagtctgtcacgcttgtccac
aaaggaaacatcatgaagttcactgaaggggcatttaaaaactggggctacgagcttgcc
gaaagagaatacggagataaagtattcacttgggctgaatatgaccgcattgtcgaaaaa
gacggaaaagaagcggctgataaagcgcagagcgatgcggaagcggcaggaaaaatcatc
gtcaaagacagcatcgctgatattttccttcagcagatcttaacccgtccgagcgaattc
gacgtcgtggcgacaatgaacttaaacggagactatatctctgatgcgcttgccgctcag
gtaggcggaatcggaatcgcgccgggagcgaacatcaactatgaaacagggcatgcgatt
ttcgaagcgactcacggaacggctcctaaatatgccggccttgacaaagtcaacccgtca
tccgtcatcctttcaggagtgcttcttcttgaacacctgaactggaatgaggctgctgac
ttgatcattaaatctatggaaaaaacgattgcttcaaaagtagtaacgtacgattttgct
agattaatggacggcgcaactgaagtgaaatgttcagagtttggtgaagagctaattaaa
aacatggactga

DBGET integrated database retrieval system