KEGG   Bacillus velezensis FZB42: RBAM_026490Help
Entry
RBAM_026490       CDS       T00582                                 

Gene name
ytcI
Definition
(GenBank) YtcI
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
bay  Bacillus velezensis FZB42
Pathway
bay00010  Glycolysis / Gluconeogenesis
bay00620  Pyruvate metabolism
bay00630  Glyoxylate and dicarboxylate metabolism
bay00640  Propanoate metabolism
bay00680  Methane metabolism
bay01100  Metabolic pathways
bay01110  Biosynthesis of secondary metabolites
bay01120  Microbial metabolism in diverse environments
bay01130  Biosynthesis of antibiotics
bay01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bay00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RBAM_026490 (ytcI)
   00620 Pyruvate metabolism
    RBAM_026490 (ytcI)
   00630 Glyoxylate and dicarboxylate metabolism
    RBAM_026490 (ytcI)
   00640 Propanoate metabolism
    RBAM_026490 (ytcI)
  09102 Energy metabolism
   00680 Methane metabolism
    RBAM_026490 (ytcI)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:bay01004]
    RBAM_026490 (ytcI)
Enzymes [BR:bay01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     RBAM_026490 (ytcI)
Lipid biosynthesis proteins [BR:bay01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   RBAM_026490 (ytcI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C Ribosomal_L6e_N
Motif
Other DBs
NCBI-ProteinID: ABS75007
UniProt: A7Z7N1
LinkDB All DBs
Position
complement(2776408..2777994)
Genome map
AA seq 528 aa AA seqDB search
MLKREDLIAPKNYNLVNEIEKFSRSKEKNALIWEDQTGGKKVWTYEKLMEETNKIGARLK
GLGFEKGDKLIVMVPRVLEAYAVYLAILKAGMVVIPCSEMLRAKDLEYRIKHAEVKGAIV
YPSFINAFDEVNTEQLVTLSIGENNVGWKNLLTIEADGDSFQTADTTREDMAFLSYTSGT
TGQPKGVVHTHGWAFAHLKTSAGAWLDISEDDTVWATAAPGWQKWVWSPLLAILGSGATG
VIYHGRFNAKTYLELLERHQVNVFCCTPTEYRLMAKVEELDKYDLSALHSAVSAGEPLNR
EVIDVFRKHFGIKVRDGYGQTESTLLVGVLKDMDIKPGSMGKPTPGNQVEIINDKGEICE
TGETGDIAVHLSTPALFKEYYKDPERTKKQIRGDYFLTGDRAKKDEDGYFWFESRNDDII
VSSGYTIGPFEVEDALVKHPEVKECAVVASPDEIRGSIVKAYVVLQDDEKRSDELVKELQ
NHVKTITAPYKYPREIEFVESLPKTASAKIRRVELRQREERLKADKKA
NT seq 1587 nt NT seq  +upstreamnt  +downstreamnt
gtgttaaaacgagaagatttaatcgccccaaagaactataaccttgtaaatgaaatcgaa
aagttcagccgttccaaagagaagaacgcgcttatatgggaagatcaaacaggcggaaag
aaagtctggacgtatgaaaaattgatggaagaaacgaataaaatcggagcccgcctgaaa
ggtctcggatttgaaaaaggcgataagctgattgtcatggttccgagagtgcttgaagcg
tatgccgtttatttagcgatcttaaaagcggggatggtcgtcattccttgctcggaaatg
ctgcgcgccaaagaccttgaataccggatcaaacacgccgaagtgaaaggcgctatcgtt
tatccttcatttataaacgcgtttgacgaggtgaataccgagcagctggtgacattgtca
atcggtgaaaataatgtcggctggaaaaacctcctaacgattgaagcggacggagacagt
tttcaaacagctgatacaacaagagaagacatggcgtttttgtcctatacttcaggcacg
accggccagcctaaaggcgttgtacatacacacggctgggcctttgcccatttaaaaaca
tcagccggtgcatggctggatatttctgaagacgatacagtgtgggccaccgcggcgccc
ggctggcagaaatgggtgtggagcccgctgctcgcaattctgggaagcggcgcgacagga
gtcatttatcacggcagattcaacgccaagacgtatttagagctgctggagcgccatcaa
gtaaatgtcttctgctgtaccccgacggaataccgcctgatggcaaaagtggaggagttg
gacaaatatgatctttctgcccttcacagcgcagtttctgcgggtgagccattaaaccgg
gaagtcattgacgtattccggaagcattttggcattaaagtgagagacggatacggccaa
acggagagcaccctgttagtcggcgtcctgaaggatatggatattaagccgggaagcatg
ggcaaaccgacccccggaaatcaggtggagattataaacgataaaggcgaaatatgcgaa
acaggcgaaacgggcgatatcgccgtgcatttgagcacaccggccttattcaaggaatat
tataaagatcccgaaagaacgaaaaagcagattcgcggagattattttcttacaggagac
cgcgcgaaaaaagacgaagacggctacttttggtttgagagccgcaatgatgacattatc
gtcagctccggatatacaatcgggccttttgaagtagaggacgcgctcgtgaagcatccg
gaagtgaaagaatgtgccgtcgtggcgagcccggatgaaatcagaggttcaatcgtaaaa
gcttatgtcgttttacaagacgatgaaaagcgcagtgacgaacttgtcaaagaactgcaa
aaccacgtaaaaacgattacggcgccttacaaatatccgagagaaattgagtttgtcgaa
agcctgccgaaaacggcgtccgcaaaaatcagacgtgtggagctgagacagcgtgaagaa
cggctgaaggctgataaaaaagcataa

DBGET integrated database retrieval system