KEGG   Bacillus velezensis FZB42: RBAM_029980Help
Entry
RBAM_029980       CDS       T00582                                 

Definition
(GenBank) DHA2 family efflux MFS transporter permease subunit
Organism
bay  Bacillus velezensis FZB42
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MFS_1 TRI12 Sugar_tr MFS_3 OATP MFS_2 MFS_1_like
Motif
Other DBs
NCBI-ProteinID: ABS75329
UniProt: A7Z8K3
LinkDB All DBs
Position
3113661..3115256
Genome map
AA seq 531 aa AA seqDB search
MSIEKKDPKRTLLITGLIIAMFFSALDGTIVGTAIPKIVGDLGGLSMMTWLTTAYLLTST
TIVPIAGKLADLLGRRVVYVSGLLIFMGASALCGMASNMTELIIFRGLQGIGGGVMMPMA
MIVIGDLFTGKQRAKFQGLFGAIYGLASVIGPQIGGWIVDSLNWKWVFYINLPVGILAVI
FIARGLQGRKQTGPINFDIAGIFTMIVGIVSLLLALSFGGKDYAWGSWQILGLFALALAG
IVGFIFAEIKAKEPILPMYLFKNRTFTVLNLIGFFMSIGMFGAVTFVPFFMQGIIGVSAT
ASGTIMTPMMVSMIITSIIGGQLVYKIGIKPQIMIGMLIMAVGFFLLTTLQLDTSKLAAT
CYMAVIGLGMGLVMPLLTLALQETFSKEELGVVTSSSQFFRMIGGTFGITVLGAVMNARS
GSLLTDRLVPYLDSLPKQASAFAAQFKGMIDKNPEGLLQSLFSQESIKQIPAAFSSHIVP
VLKTSLMDSLHSVFFTGLAFIAAGLILTLFVKSIKLTNKKTGKQEEKAKAV
NT seq 1596 nt NT seq  +upstreamnt  +downstreamnt
atgagcattgaaaagaaagatccaaaacgcacattattaataaccggcttaatcatcgcc
atgtttttctcagcccttgacggcaccatcgtaggaacagcgattcctaaaatcgtgggt
gacctcgggggattaagcatgatgacgtggctgaccacggcatatcttttaacttcgacg
acgatcgttccgattgcggggaaacttgcagatttattggggcgccgcgtcgtctatgta
tcaggtttattgatttttatgggagcttccgcactgtgcggaatggccagcaacatgacg
gaactgattattttccgcggacttcagggaatcggcggcggtgtcatgatgccgatggct
atgatcgtcatcggggatttgttcacagggaaacagcgtgccaagttccaagggcttttc
ggggcgatttacgggcttgcttccgtgatcggcccgcaaatcgggggctggattgttgac
tcattaaattggaaatgggttttctatatcaacctgcctgtcggaattttagccgtgatc
tttatcgcaagaggacttcaaggcagaaaacagaccgggccgattaactttgacatcgcc
ggcattttcacaatgatcgtcggaatcgtcagcctcctcctcgcgctcagcttcggagga
aaggattacgcatggggctcttggcagattctcggtctctttgcgcttgcacttgccggg
attgtcggattcattttcgctgaaatcaaagcaaaagaaccgattctgccgatgtacctg
tttaaaaacagaacgtttaccgtactgaatctgatcggctttttcatgagtatcggcatg
ttcggcgccgttacgttcgttcctttctttatgcagggaattatcggagtcagcgccacc
gcgtccggcacgattatgacaccgatgatggtatctatgattatcacaagtattatcgga
ggccagctggtttataagatcggtattaaaccgcaaatcatgatcggcatgctgatcatg
gccgtcggcttcttcttattaacgaccttacagctggatacaagcaagctcgcggctaca
tgctatatggccgtgatcggtctgggaatggggctcgtcatgccgcttctcacgctcgct
ctgcaagaaacgttttcaaaagaagagctgggtgttgtgacctcttcaagccaatttttc
cggatgatcgggggaacgttcggcattacggtgctcggcgctgtcatgaatgccagatca
ggaagccttttaaccgacagactggtgccttacttagactcactcccgaaacaggcaagt
gcctttgccgcccagtttaaaggtatgattgacaagaatcctgaagggctgcttcaatcc
ttgttcagccaggaatcgattaagcagattccggccgcattttcttcccatatcgtgccg
gttttgaaaacgtcactgatggattcgcttcacagcgtgtttttcacaggcctggccttt
atcgctgccggattgatcctcacgctgtttgttaaatcaattaaactgacaaacaaaaag
acaggcaaacaagaagaaaaggcgaaagccgtttaa

DBGET integrated database retrieval system