KEGG   Bacillus velezensis FZB42: RBAM_029990Help
Entry
RBAM_029990       CDS       T00582                                 

Definition
(GenBank) tautomerase family protein
Organism
bay  Bacillus velezensis FZB42
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Tautomerase_2 Tautomerase VASt
Motif
Other DBs
NCBI-ProteinID: ABS75330
UniProt: A7Z8K4
LinkDB All DBs
Position
complement(3115291..3115671)
Genome map
AA seq 126 aa AA seqDB search
MPFVQIHLQKGKSGFWLKKMSAVIHTAMTEMIDVPHGDYFQVVHQHEKGEFFYDPSYLQV
ERSDELMFIRFTLKNSRTTHQKQAFYQHLADRLHEKLGVRKEDVFIVLSGNAAEDWSFGN
GEAQMI
NT seq 381 nt NT seq  +upstreamnt  +downstreamnt
atgccgtttgtacagattcatttacagaaagggaaaagcggattttggcttaaaaaaatg
agcgccgttattcataccgcgatgacggagatgattgatgttccgcatggtgactatttt
caagtggtgcaccagcacgaaaaaggggagtttttctatgatccgtcatatcttcaagtt
gagcggagcgatgaactgatgtttatccgctttactttgaaaaactccagaacaactcat
cagaaacaagcattctatcagcatttggctgaccggctgcacgaaaagctgggcgtcaga
aaagaagatgtgtttatcgtcctctcaggcaatgcggcggaagactggtcattcggaaac
ggagaggcccagatgatataa

DBGET integrated database retrieval system