KEGG   Bacillus velezensis FZB42: RBAM_030010Help
Entry
RBAM_030010       CDS       T00582                                 

Gene name
yusT
Definition
(GenBank) YusT
Organism
bay  Bacillus velezensis FZB42
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LysR_substrate HTH_1 HTH_20 HTH_30 HTH_24
Motif
Other DBs
NCBI-ProteinID: ABS75332
UniProt: A7Z8K6
LinkDB All DBs
Position
3116557..3117432
Genome map
AA seq 291 aa AA seqDB search
MESGDLRIFQMVAREGSITKAAARLGYVQSNVTARIRQLEEDLKTELFFRHNRGMTLSSS
GTVLLHYADQVVGLIEEAKMALASTDKPSGPLMIGSTQTTAAVRLPKLLASYYERYPDVE
LSLTTGHTQYVTDKVLRYELDGAFIGCHFHHPDLHSIPAFEEEAVVVTPAAVTAIEEAVK
KPLLVYSTGCTYRDTLERWLHSIGTAHPAIMEFGTLEAIIGGVTAGLGITLLPRSVITQH
AALGAVRIWTIPESFSMMKTEFVTRKDSYMSCALRAFIDSFSAKKASGTSL
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
atggaaagcggagatttgcgaatttttcagatggtggcccgtgaaggttccattacaaag
gcggctgcgcgtctcggctatgtgcagtcaaacgtgacggccagaatccgccagctggaa
gaagatttgaaaactgagctgtttttccgccataaccgcgggatgacgctgtcttcaagc
ggcacggtgctcctccattatgcggatcaggtcgtcggtctgatagaagaagccaaaatg
gcgctcgcttcaacagacaagccaagcggaccgcttatgatcggctccacccagacaaca
gccgccgtcaggctgccgaaacttttagcctcttactatgagcggtatcctgatgtggag
ctgtcccttacgacaggacatacacaatatgtaaccgataaagttcttcgctatgaattg
gacggcgcatttatcggctgtcactttcatcatccggatttgcactccatcccggccttt
gaagaagaagccgttgtcgtgactcccgctgccgtcaccgctatagaagaagcggtaaaa
aagccgcttcttgtgtacagcacgggctgcacgtatcgtgacacattagagcggtggctt
cattccattggaacggcgcatccggccattatggaattcggcacccttgaagcgattatc
gggggagtgacagcggggctcggcattacgctgctcccgcgaagcgtaattactcagcac
gccgcactaggcgcggttcggatatggaccattcccgaatctttcagcatgatgaaaacg
gaattcgttacgcggaaggattcatatatgagctgtgcattacgggcctttattgattcc
ttttcagcaaaaaaagcttccggcacctctctttga

DBGET integrated database retrieval system