KEGG   Bacillus velezensis FZB42: RBAM_030060
Entry
RBAM_030060       CDS       T00582                                 

Definition
(GenBank) ABC transporter ATP-binding protein
  KO
K02013  iron complex transport system ATP-binding protein [EC:7.2.2.-]
Organism
bay  Bacillus velezensis FZB42
Brite
KEGG Orthology (KO) [BR:bay00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bay02000]
    RBAM_030060
Transporters [BR:bay02000]
 ABC transporters, prokaryotic type
  Metallic cation, iron-siderophore and vitamin B12 transporters
   Iron complex transporter
    RBAM_030060
SSDB
Motif
Pfam: ABC_tran AAA_21 AAA_15 AAA_16 SMC_N AAA_29 AAA_30 ABC_ATPase RsgA_GTPase AAA_25 AAA_23 AAA_5 NACHT AAA_28 AAA_33 AAA_22 Mg_chelatase AAA AAA_19 Zeta_toxin SRP54 Viral_helicase1 ATPase_2 AAA_14 AAA_27 RNA_helicase AAA_18 ATP-synt_ab DUF815 Rad17 G-alpha
Other DBs
NCBI-ProteinID: ABS75337
UniProt: A7Z8L1
LinkDB
Position
complement(3121205..3122029)
AA seq 274 aa
MSAISTETLSLGYGETVIIDELDVAIPKGEITVLIGSNGCGKSTLLRSLARLMKPRGGSV
LLEGKAIAKLPTKEVARELAILPQSPSAPEGLTVHQLVKQGRYPYQSWLKQWSKEDEDAV
AKALKATKLEEMADRPVDSLSGGQRQRAWIAMTLAQDTDIILLDEPTTYLDMTHQIEILD
LLFELNEKEKRTIVMVLHDLNLACRYAHYLVAIKDKQIYAEGRPEEVITCELVQQVFAMN
CQVTQDPLFGTPLCIPHGRGRCIVQEAALTARLS
NT seq 825 nt   +upstreamnt  +downstreamnt
atgagtgcaatttctacagagacgctgagcttagggtacggagaaactgttatcattgac
gaattggatgtcgcgattccaaaaggcgaaatcactgtattgatcggaagcaacggctgc
ggaaaatcgacgcttttacgttcattggcccggctgatgaaaccgaggggcggttctgtg
cttttagaaggaaaagccatcgctaagcttccgacgaaggaagtggcaagagagctcgct
attttgccgcagagtccgtcagctcccgaaggcctgacggtgcatcagcttgtgaagcag
ggaagatacccttatcaaagctggctgaagcaatggtccaaagaggacgaagacgcagtg
gcaaaagcgcttaaagcgacgaagcttgaggaaatggccgaccgtccggtggattccttg
tcaggcggacagcgccagcgcgcatggattgcgatgacactcgctcaggatacggatatc
attctgcttgacgagccgacaacctatctcgacatgacgcatcaaattgaaattcttgat
ttgctgtttgaattaaatgaaaaagaaaaacgcacaatcgtcatggtgctgcacgacctg
aatctggcatgccgttatgcccattatctggtcgccattaaggataaacagatttacgca
gagggccgtcccgaagaagtcatcacttgcgagcttgtacagcaggtctttgcgatgaac
tgccaggtaacgcaagatccgctgttcggcacgccgctttgcattccgcacggacgcggc
agatgtatcgtgcaggaagcggccctcaccgcccgattgtcataa

DBGET integrated database retrieval system