KEGG   Bacillus velezensis FZB42: RBAM_036890Help
Entry
RBAM_036890       CDS       T00582                                 

Gene name
aldX
Definition
(GenBank) AldX
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
bay  Bacillus velezensis FZB42
Pathway
bay00010  Glycolysis / Gluconeogenesis
bay00053  Ascorbate and aldarate metabolism
bay00071  Fatty acid degradation
bay00280  Valine, leucine and isoleucine degradation
bay00310  Lysine degradation
bay00330  Arginine and proline metabolism
bay00340  Histidine metabolism
bay00380  Tryptophan metabolism
bay00410  beta-Alanine metabolism
bay00561  Glycerolipid metabolism
bay00620  Pyruvate metabolism
bay00625  Chloroalkane and chloroalkene degradation
bay01100  Metabolic pathways
bay01110  Biosynthesis of secondary metabolites
bay01120  Microbial metabolism in diverse environments
bay01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:bay00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RBAM_036890 (aldX)
   00053 Ascorbate and aldarate metabolism
    RBAM_036890 (aldX)
   00620 Pyruvate metabolism
    RBAM_036890 (aldX)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    RBAM_036890 (aldX)
   00561 Glycerolipid metabolism
    RBAM_036890 (aldX)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    RBAM_036890 (aldX)
   00310 Lysine degradation
    RBAM_036890 (aldX)
   00330 Arginine and proline metabolism
    RBAM_036890 (aldX)
   00340 Histidine metabolism
    RBAM_036890 (aldX)
   00380 Tryptophan metabolism
    RBAM_036890 (aldX)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    RBAM_036890 (aldX)
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    RBAM_036890 (aldX)
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    RBAM_036890 (aldX)
Enzymes [BR:bay01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     RBAM_036890 (aldX)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: ABS76018
UniProt: A7ZAJ2
LinkDB All DBs
Position
3797618..3798955
Genome map
AA seq 445 aa AA seqDB search
MDQHIKADIKRVFELQKKNQKTLRASTAGQRREKLQRFLDAVTAHEEEIIEAIRRDVRKP
YHEVKRAETQGTIKAIKDNMNNLDTWMAPKRVGSSVSPDADGVLMYEPKGLTLILGPWNY
PFMLTMAPLAAAIAAGNSAIVKLSDFTMETSHIAATVIREAFHEEEVAIFEGEVDVATEL
LDQPFDHIFFTGSTNVGKIVMTAAAKHLSSVTLELGGKSPTIIDSGYDLMDAAKKIAVGK
FVNAGQTCIAPDYLLMKKEVQSTFTDLLQTIVNAGFMEDDHTVDRNKFTQIVNDRNFNRV
KALYDDAIEKGAKTAFGGVFDAHDRTISPTVLTNVTPDMKIMQEEIFAPILPIMNYEDIS
EAVDYITERDKPLALYVFSHNQELIDYVLQHTTSGNASVNDVVVHFTDVNLPFGGVNTSG
IGSYHGVYGFKEFSHEKGVFIQASK
NT seq 1338 nt NT seq  +upstreamnt  +downstreamnt
atggatcagcatataaaagcagacatcaaacgcgtctttgagcttcagaaaaaaaatcaa
aaaacgctgcgtgcttcaacagccgggcagcgcagagaaaagcttcagcgctttttagat
gccgtcaccgcacatgaagaagaaatcattgaggcgatcagacgggacgtccgcaagcct
tatcatgaggtgaaaagagcggaaacgcagggaacgatcaaggcgattaaagataatatg
aacaatctcgacacctggatggcgccgaaacgcgtcggctcatccgtcagccccgacgct
gacggcgtattaatgtacgagccaaaaggccttaccttaattctcggcccgtggaattat
ccgtttatgctgacgatggctccgcttgcagctgccattgcggccggcaacagcgcgatt
gtgaagctgtccgattttacaatggagacgagccatatcgccgcgacagttattcgcgag
gcatttcatgaagaagaagtcgccatttttgaaggtgaggtcgatgtcgccacagaactg
ctcgaccagccgtttgaccacattttcttcaccggaagcacgaatgtcggtaaaatcgtc
atgacggcagcggcgaagcacttgtcgtccgtcacgcttgagcttggcggaaaaagcccg
acgatcatcgacagcggctatgatttgatggacgcggcgaaaaaaatcgccgtcggcaaa
tttgtcaatgcggggcaaacatgtatcgcacctgactatctccttatgaagaaagaagtg
cagagcacctttacagatctcctgcaaaccattgtcaatgcaggttttatggaggatgat
catacggttgaccgcaacaaattcacgcagattgtcaacgaccgcaactttaaccgtgtc
aaagccctgtatgatgacgccattgaaaaaggggcgaaaacggcgttcggcggcgtattc
gatgcgcatgaccgcacgatttctccgaccgtgctgacaaacgtgacgcctgatatgaag
atcatgcaggaagaaatcttcgcaccgattctgccgattatgaattacgaagatatcagt
gaagccgttgattacatcactgaacgggacaagccgcttgccttgtatgtattcagccat
aatcaggagctgatcgattatgtgctgcagcatacgacatccggcaatgcttctgtcaat
gatgtcgtcgttcatttcactgacgtcaaccttccgttcggcggtgtcaatacgagcggg
atcggttcatatcacggtgtgtacggctttaaagaattttctcatgaaaaaggcgtattt
attcaagcctctaaataa

DBGET integrated database retrieval system