KEGG   Bacillus amyloliquefaciens TA208: BAMTA208_01780Help
Entry
BAMTA208_01780    CDS       T01824                                 

Gene name
yclQ
Definition
(GenBank) iron-siderophore ABC transporter (binding lipoprotein)
  KO
K02016  iron complex transport system substrate-binding protein
Organism
baz  Bacillus amyloliquefaciens TA208
Brite
KEGG Orthology (KO) [BR:baz00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:baz02000]
    BAMTA208_01780 (yclQ)
Transporters [BR:baz02000]
 ABC Transporters, Prokaryotic Type
  Metallic cation, iron-siderophore and vitamin B12 transporters
   Iron complex transporter
    BAMTA208_01780 (yclQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peripla_BP_2 DDE_Tnp_IS1 LPAM_1
Motif
Other DBs
NCBI-ProteinID: AEB22545
LinkDB All DBs
Position
370996..371946
Genome map
AA seq 316 aa AA seqDB search
MKKFALLFIALVTIFVVSACGNGNGDKTSGKSKETITIKDDLNKEGVKVPKNPKKVVVFN
FGMLDTMDELGLQDHVAGLPKQSIPKYLSSYKSDKYANTGGLKEPDFEKVADIDPDLIII
AHRQSDSYKEFSKIAPTIYLDDDYTNYVDRFKHNTEVIGKIFNKENEVKDKLAKIDKSIA
DLKKKTSSTDKNGLVVMANDGKISAFGSKSRYGFIHDVFGVKPADKNIEASLHGQSISYE
YIAKTNPDYLFVVDRGTAIGSKSSTKQVVENDYVKSVKAVKNNHVVYLDSATWYLSGGGL
ESMAQMVKEVKNGIEK
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaattcgcattgcttttcattgcgctcgttacgatttttgttgtttctgcatgc
ggaaacggaaacggggacaaaacatcaggcaaatcaaaagaaacaatcacgattaaggat
gacctgaacaaagaaggagtcaaagtgccgaagaatccgaagaaagtcgtcgtattcaac
ttcggaatgctggatacgatggatgaactcggtttacaggatcatgtcgcgggacttccg
aaacaaagcattccaaaatacttatcttcatacaaaagtgataaatacgccaatacaggc
ggtttaaaagaaccggatttcgaaaaagtcgcggatattgatccggatttaatcattatc
gctcacagacaatctgattcttacaaagagttctcaaaaatcgcgccgacgatttatctt
gatgatgactatacaaactacgttgacagattcaagcataacaccgaagtgatcggcaaa
attttcaacaaagaaaatgaagtgaaagataagcttgcgaaaattgacaaatccattgct
gatctgaagaaaaagacaagcagcacggataaaaacggtttagtggtgatggcgaacgac
gggaaaatcagcgcgttcggatctaaatcaagatacggcttcattcatgatgtgttcggc
gtcaaaccggctgacaaaaacatcgaagcatcactgcacggacaaagcatttcctatgaa
tatatcgccaaaacaaaccctgattacttgtttgtcgttgaccgcggaacagcgatcggc
tcaaaatcttcaacaaaacaagtggttgaaaatgattatgtgaaatcggtgaaagccgtg
aaaaacaaccatgttgtataccttgactcagctacatggtacttatcaggaggcggcctg
gaatccatggcgcaaatggtgaaagaagtaaaaaacggaattgagaagtaa

DBGET integrated database retrieval system