KEGG   Bacillus amyloliquefaciens TA208: BAMTA208_02265Help
Entry
BAMTA208_02265    CDS       T01824                                 

Gene name
rsbS
Definition
(GenBank) RsbS protein
  KO
K17762  rsbT antagonist protein RsbS
Organism
baz  Bacillus amyloliquefaciens TA208
Brite
KEGG Orthology (KO) [BR:baz00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:baz03021]
    BAMTA208_02265 (rsbS)
Transcription machinery [BR:baz03021]
 Prokaryotic type
  Bacterial type
   Other transcription-related factors
    RNA polymerase-associated proteins
     BAMTA208_02265 (rsbS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: STAS STAS_2 NAD_binding_3
Motif
Other DBs
NCBI-ProteinID: AEB22640
LinkDB All DBs
Position
459325..459690
Genome map
AA seq 121 aa AA seqDB search
MRHPKIPILKLYNCLLVSIQWELDDQTALHFQEDLLNKIYETGANGVVIDLTSVDMIDSF
IAKVLGDVITMSKLMGAKVVLTGIQPAVAVTLIELGISLEEIETALDLEQGLETLKRELG
E
NT seq 366 nt NT seq  +upstreamnt  +downstreamnt
gtgagacatccaaaaatcccgattctgaaactgtataactgcttattggtatccatccaa
tgggagcttgacgaccagactgctctgcattttcaagaagacctgctgaacaaaatctat
gaaactggcgcaaacggggtcgtcattgacctgacatccgtcgacatgatcgattcattt
attgcgaaagtgcttggcgatgtcattaccatgtcaaaattgatgggcgcaaaggtcgta
ttgacaggaattcagccagctgtagcggtcacattgattgaacttggaatctcacttgag
gaaatcgaaacggcgctcgacttagagcaggggcttgagacattgaagcgggaattgggg
gaatag

DBGET integrated database retrieval system