KEGG   Bacillus amyloliquefaciens TA208: BAMTA208_02340Help
Entry
BAMTA208_02340    CDS       T01824                                 

Gene name
ybfB
Definition
(GenBank) YbfB
Organism
baz  Bacillus amyloliquefaciens TA208
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MFS_1
Motif
Other DBs
NCBI-ProteinID: AEB22655
LinkDB All DBs
Position
472381..473643
Genome map
AA seq 420 aa AA seqDB search
MPIKYHYAWIIVFVTFLTFLAVQGARLSFGAFVEPWEKDFSMNRGTISLISTLSFIIYGI
SQPIIGRLVDKLGPRMILSISTFLVGLSFILTSFVNHPWQLFILYGIVISVGVGGASNVA
ATVVVTNWFNEKRGLAFGIMEAGFGAGQMLLVPGSLILIQWFDWKLTVVILGLLLMVIVF
PVILLFLRNHPGEMGLSPMGGFIKAEAESDQHTAHFSVWAVFCKKQFWFLILPFAICGFT
TTGLMDTHLIPFSHDHGFSTSVTSAAVSVLAGFNILGIIISGIAADRWSSKKMLILLYVI
RALSICILLYSHHSIILLIFATLFGLVDFATVAPTQMLATQYFKQYSVGFILGWLFLSHQ
IGSALGAYVPGFLYSEIGNYDLSFYFSIIILLGAAMFTFLLPETVKIKKEEKPETDSVSY
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
atgccaataaaatatcattatgcatggatcattgtttttgtcacttttttaaccttttta
gcggttcaaggcgcacgtctttcatttggagcttttgttgaaccatgggaaaaagatttt
tctatgaatagaggaacaatttcacttatttccactctgagttttatcatatatggcata
tctcagcccataatagggaggctggttgataaattaggaccccgaatgattttatcaatc
agcacatttttggtcgggcttagctttattttaacgtcttttgtgaatcatccatggcag
ttatttattctttatggaattgttatctccgtcggtgttggaggggcatctaatgtagcc
gcgacagttgttgttacaaattggtttaatgaaaaacgcggactcgctttcggaattatg
gaggcagggtttggtgccggtcagatgcttcttgttcccggctctctcattttgattcaa
tggtttgattggaagttaactgtagtgattttgggtctgcttttaatggttattgtgttt
cctgtcatactgttatttttacggaatcatcccggcgagatggggttatctcctatgggc
ggttttatcaaagcagaagctgaaagtgaccagcatacggcccacttttctgtttgggca
gtgttttgcaagaaacaattctggtttttaatactaccttttgctatatgcggttttaca
actacaggcctgatggatactcaccttattcctttttctcatgaccatggattttcaaca
agtgtaaccagtgctgcggttagtgtgttggcgggatttaatattttggggataatcatt
tcaggaattgcggcagaccgttggagcagtaaaaagatgcttattcttttatatgtcatc
cgcgcattatcaatttgcatcctgttatacagtcatcattcgattatattacttattttt
gcaactttgtttggactggttgattttgcaactgtagctcctacccaaatgttagccacg
caatattttaagcaatattcagttggttttattttaggctggttattcctgagccatcag
ataggatcagcgctgggagcttatgtaccaggttttctttatagtgaaataggtaactat
gatctttctttttatttctcaattattattttgttgggagcggcaatgtttactttctta
ctgcctgaaactgtgaaaataaaaaaagaggaaaagccggagactgattcagtttcatat
taa

DBGET integrated database retrieval system