KEGG   Bacillus amyloliquefaciens TA208: BAMTA208_02385Help
Entry
BAMTA208_02385    CDS       T01824                                 

Gene name
yddJ
Definition
(GenBank) hypothetical protein
Organism
baz  Bacillus amyloliquefaciens TA208
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: AEB22664
LinkDB All DBs
Position
complement(480724..480846)
Genome map
AA seq 40 aa AA seqDB search
MDYMQETDFFVAVLEGDFHLLHSKEEDGLDSLEEDADFIK
NT seq 123 nt NT seq  +upstreamnt  +downstreamnt
ttggattatatgcaagaaaccgattttttcgtggcggttttagaaggggattttcacctc
ttgcattcgaaagaagaagacggtttggattcgttggaagaggacgcagattttattaag
tga

DBGET integrated database retrieval system