KEGG   Bacillus amyloliquefaciens TA208: BAMTA208_02550Help
Entry
BAMTA208_02550    CDS       T01824                                 

Gene name
yraF
Definition
(GenBank) putative spore coat protein
Organism
baz  Bacillus amyloliquefaciens TA208
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Coat_F DUF3231
Motif
Other DBs
NCBI-ProteinID: AEB22697
LinkDB All DBs
Position
complement(511090..511458)
Genome map
AA seq 122 aa AA seqDB search
MNHDHLDPINSLHVPELADMTFAMDFLIRAKEGVRNTAVALTETASPDVRALLRKQLMQG
IAMHQEITDLMVSKKWFHPHDLSEQYKLDQLSAKNTLMVGNMNLFPVETNRKGMFDRTPD
EH
NT seq 369 nt NT seq  +upstreamnt  +downstreamnt
ttgaatcatgaccatttagatccaatcaattcattacatgtccctgaactcgcagatatg
acattcgcaatggattttctcatacgcgccaaagaaggcgtcagaaataccgccgtcgct
ttaacggaaaccgcttcacctgatgtaagggctttgctgcgcaaacagctcatgcaagga
atcgcgatgcaccaggagattacagacttgatggtcagcaaaaagtggtttcacccgcat
gatctgagcgaacagtataaattggatcagctttcagcgaaaaataccctcatggtcgga
aacatgaacctgtttcccgttgaaacaaacagaaaaggaatgtttgaccgtacacctgat
gaacactaa

DBGET integrated database retrieval system