KEGG   Bacillus amyloliquefaciens TA208: BAMTA208_02585Help
Entry
BAMTA208_02585    CDS       T01824                                 

Gene name
gldA
Definition
(GenBank) glycerol dehydrogenase
  KO
K00005  glycerol dehydrogenase [EC:1.1.1.6]
Organism
baz  Bacillus amyloliquefaciens TA208
Pathway
baz00561  Glycerolipid metabolism
baz00640  Propanoate metabolism
baz01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:baz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    BAMTA208_02585 (gldA)
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    BAMTA208_02585 (gldA)
Enzymes [BR:baz01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.6  glycerol dehydrogenase
     BAMTA208_02585 (gldA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fe-ADH Fe-ADH_2 MMR_HSR1_Xtn DegS
Motif
Other DBs
NCBI-ProteinID: AEB22704
LinkDB All DBs
Position
516746..517879
Genome map
AA seq 377 aa AA seqDB search
MEDIKEGMMTLERIFISPAKYVQGKNAIETIGGHLEGVGEKAVVIADKTVWDIAGHKVTA
ELKKSNISSEEAVFNGEASQEEMKRIAGIAEKAGASIVIGVGGGKTLDTAKAVSDEINGY
TVIVPTAASTDAPTSGLSVVYSEQGAFENYRFYHKNPDLVLVDTKIVAEAPPRFLASGIA
DAMATWVEARSVIANGGKTMAGGIPTIAGEAIAEKCEEVLFKYGHLAYESVKAKVVTPPL
EAVVEANTLLSGLGFESGGLAAAHAIHNGFTALEGEIHHLTHGEKVAFGTLVQLALEKRS
LEEIERYIAFYISLGLPVTLEDIKLKDASKEDIMKVAEAATIEEETIHAAFDVTADDVAD
AIIAADQYAKAFKEKHA
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atggaagacatcaaagaagggatgatgacattggaacgaatttttatcagtccggccaaa
tatgtgcaaggaaaaaacgcaattgaaacaatcggcggacatctggagggcgttggtgaa
aaagccgtcgtcattgccgacaaaaccgtatgggatatcgctggtcacaaagtgacggct
gaattaaagaaaagcaatatctcctctgaagaggcggttttcaacggagaagcttcccag
gaagaaatgaaaagaattgcgggcattgcagaaaaagcgggtgcgtccattgtgatcgga
gtcggcggcggtaaaacgcttgatacggccaaagccgtatcagatgaaataaacggctac
acggttatcgtgccgacggccgcttcaacggatgctccgacaagcggactgtctgtcgtt
tattcagaacaaggcgcgtttgaaaactatcgtttctaccataagaatcctgacctggtt
ctggtcgatacgaaaatcgtcgcggaagccccgccgcgttttttagcatcaggtattgcc
gatgcgatggcgacgtgggtagaggcgcgcagtgtcatcgccaatggcggtaaaacgatg
gcgggcggaattcctacaatcgcaggagaagccatcgcggaaaaatgtgaagaagtacta
ttcaaatatggccatctcgcctatgaatccgtaaaagcgaaagtcgtcactcctccattg
gaagcggtggttgaagccaatacacttctgagcggactgggatttgaaagcggcggcttg
gctgcggcgcatgccattcacaacggcttcaccgcgcttgaaggtgagatccatcacttg
actcacggtgaaaaagtggcattcggcacgctcgttcaactggcgctggaaaaacgttcg
cttgaagaaattgagcggtatatcgcgttttatatcagcttggggctgcctgtcacactt
gaagacatcaaattgaaagacgcatctaaagaggacattatgaaagtggcagaagccgca
accattgaagaagaaacgatacatgccgcttttgatgtcacggctgatgacgtggcagat
gccattatagcggccgaccaatacgcaaaagcgtttaaagaaaagcatgcgtaa

DBGET integrated database retrieval system