KEGG   Bacillus amyloliquefaciens TA208: BAMTA208_02665Help
Entry
BAMTA208_02665    CDS       T01824                                 

Definition
(GenBank) hypothetical protein
Organism
baz  Bacillus amyloliquefaciens TA208
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Wzy_C
Motif
Other DBs
NCBI-ProteinID: AEB22720
LinkDB All DBs
Position
complement(531999..532172)
Genome map
AA seq 57 aa AA seqDB search
MKTKVFAVVLGAVLMIAGLLLAEVSLYMEYITMLGAMIFSSIFMSEPKIKFRIIKGV
NT seq 174 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacgaaggtttttgcggtggtattgggcgctgttttaatgattgcgggtttgctt
ttggcagaggtttcactttatatggaatacatcacaatgctcggagctatgattttttct
tctatatttatgtcagagccgaaaataaaatttcgcataatcaaaggggtttga

DBGET integrated database retrieval system