KEGG   Bacillus amyloliquefaciens TA208: BAMTA208_02695Help
Entry
BAMTA208_02695    CDS       T01824                                 

Gene name
yydR
Definition
(GenBank) molecular chaperone
  KO
K11741  quaternary ammonium compound-resistance protein SugE
Organism
baz  Bacillus amyloliquefaciens TA208
Brite
KEGG Orthology (KO) [BR:baz00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:baz02000]
    BAMTA208_02695 (yydR)
Transporters [BR:baz02000]
 Other Transporters
  Electrochemical potential-driven transporters [TC:2]
   BAMTA208_02695 (yydR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Multi_Drug_Res EamA
Motif
Other DBs
NCBI-ProteinID: AEB22726
LinkDB All DBs
Position
complement(537280..537594)
Genome map
AA seq 104 aa AA seqDB search
MAWLLLFIAGAEEVVAAVAMKHIDGFKKKWPLIVMTTGFMLSFFCLSEAMQVLPTGVAYA
AWTGMGSIGVSAVGILWFKEKFNLSQLVSLGLILIGVIGLKLTT
NT seq 315 nt NT seq  +upstreamnt  +downstreamnt
atggcttggctgctgttatttattgccggagcggaagaagttgtagcggccgttgccatg
aaacatattgacggctttaaaaaaaagtggccgctgattgtcatgacaacaggctttatg
ctttcattcttttgcctttctgaagcgatgcaggtccttcccacaggtgttgcgtatgca
gcttggaccggcatgggaagcatcggcgtttcggccgtgggcatactctggtttaaagaa
aaattcaatctgtcacaattggtgtctctggggcttatcctcatcggtgtcatcggttta
aaactgacgacatga

DBGET integrated database retrieval system