KEGG   Bacillus amyloliquefaciens TA208: BAMTA208_02705Help
Entry
BAMTA208_02705    CDS       T01824                                 

Gene name
yvdT
Definition
(GenBank) TetR family transcriptional regulator
Organism
baz  Bacillus amyloliquefaciens TA208
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TetR_C_26 TetR_N
Motif
Other DBs
NCBI-ProteinID: AEB22728
LinkDB All DBs
Position
complement(537995..538576)
Genome map
AA seq 193 aa AA seqDB search
MAKQSSGKYEKILQAAIEVISEKGLDKASISEIVKKAGTAQGTFYLYFSSKNALISAIAE
NLLDLTLDRIKGKTDGTEDFWTVLDILVDETFHITRLHKDIIVLCYSGLAIDHSMEKWEA
IYQPYYSWLEDVINTAIEQNVVISGIHVRWTARTIINVVENAAERFYIGCEQDVDLEVYK
KEIFSFLKRSLQK
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
ttggcaaaacaaagctcgggaaaatatgaaaagatcctgcaagccgcgattgaagtcatt
tctgaaaaaggattagacaaagcatccatttcagaaatcgttaaaaaagccggaacggcc
caaggtacgttttacttatatttttcttctaaaaacgcactgatatcagcgattgcagaa
aacctgctcgaccttacgctggacagaattaaagggaaaaccgacggcactgaagatttt
tggacggtgctggacattttggttgatgagacatttcacatcacccggcttcataaagat
attatcgtcctctgttattccggtcttgccatcgatcactcaatggaaaaatgggaggcc
atttatcagccttattattcctggctggaagacgtgatcaatacggccattgagcagaat
gtggtcatcagcggcattcatgtcagatggacggccagaacgattatcaacgttgtcgag
aacgcggctgaacgattttatatcggctgtgaacaggatgtcgatctcgaagtgtataaa
aaagaaatattcagctttcttaaaagaagcttgcagaaatga

DBGET integrated database retrieval system