KEGG   Bacillus amyloliquefaciens TA208: BAMTA208_02750Help
Entry
BAMTA208_02750    CDS       T01824                                 

Gene name
ydiD
Definition
(GenBank) ribosomal-protein-alanine acetyltransferase
  KO
K03789  [ribosomal protein S18]-alanine N-acetyltransferase [EC:2.3.1.266]
Organism
baz  Bacillus amyloliquefaciens TA208
Brite
KEGG Orthology (KO) [BR:baz00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:baz03009]
    BAMTA208_02750 (ydiD)
Enzymes [BR:baz01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.266  [ribosomal protein S18]-alanine N-acetyltransferase
     BAMTA208_02750 (ydiD)
Ribosome biogenesis [BR:baz03009]
 Prokaryotic Type
  ribosomal protein modification factors
   BAMTA208_02750 (ydiD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acetyltransf_1 Acetyltransf_10 Acetyltransf_7 Acetyltransf_3 Acetyltransf_9 FR47 Acetyltransf_8 Acetyltransf_4 Acetyltransf_6 Acetyltransf_CG Acetyltransf_18
Motif
Other DBs
NCBI-ProteinID: AEB22737
LinkDB All DBs
Position
552944..553399
Genome map
AA seq 151 aa AA seqDB search
MKTKTAIRSMRPEDIDQIYEIETASFTSPWTKDSFYHELLENPYAHYLVIEKDGCLAGYC
GIWIIIDDAQITNIAIKPEYRGQSLGEALFGSAIELCREKKARRLSLEVRVSNHPAQSLY
KKFGLQAGGIRKQYYTDNGEDALLMWVTLHE
NT seq 456 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacgaaaacggcgattcgaagcatgcggccggaagatattgatcaaatttatgaa
attgaaacagcatccttcacttctccgtggacgaaggattcattttatcatgagcttttg
gaaaatccgtatgcgcactaccttgtcattgaaaaggacggctgtctggcaggttattgc
ggaatctggattattatagatgacgcgcagattacgaacatagccattaagccggaatac
cggggccaatcattgggagaagcgctgtttggctctgcgatagaattgtgcagagaaaaa
aaggcaagaaggctctctctcgaagtcagggtctcaaatcatcccgcccaatccttatat
aaaaaattcggtcttcaggccggaggaatcagaaaacaatactatacagataacggggaa
gatgcgttattaatgtgggtgacattacatgagtga

DBGET integrated database retrieval system