KEGG   Bacillus amyloliquefaciens TA208: BAMTA208_02865Help
Entry
BAMTA208_02865    CDS       T01824                                 

Gene name
oatA
Definition
(GenBank) peptidoglycan O-acetyltransferase
Organism
baz  Bacillus amyloliquefaciens TA208
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acyl_transf_3 Lipase_GDSL_2 SpoIIIAH CDC45 FUSC_2 DisA-linker SLC12 Zip Menin SAPS RRN3 DUF913
Motif
Other DBs
NCBI-ProteinID: AEB22760
LinkDB All DBs
Position
complement(577531..579462)
Genome map
AA seq 643 aa AA seqDB search
MSDKSLNHRYIPGLDGLRAFAVLAVIAYHLNFNWADGGFIGVDIFFVLSGYLITSIILPA
QGNDITLDLRDFWVRRIRRLLPAAYLMIITTVIWVVLFNSELLHTVRGDAVSSLFYISNW
WFIFHKLSYFDSFGSPSPLKNLWSLAIEEQFYIIWPFLLLAGMHICKTRARLAAAVTFIA
LCSAVVMSMMYVPGGDPSRVYYGTDTRSFELLIGCALALVWPMKRLSSKRLPSSMKHLLH
GTELAAFAALLLCVFYTDEYEPFLYKGGMLLISITAAVLVACICHPSSFLGHVLSWKPLR
WIGTRSYGIYLWHYPVIVLSTPVQEIGNPVYWHCAVRIGATFILAELSYHFIEKPIRTAG
FRPFFRRVFLNRFLEWKTSSVISRMSLGLILAAILVFAGGLSGIAEEKKQPQWTYAQSGQ
QETAASSHKTADHDKPAKEDDSQKKYGGEKTDAASDKNKKESTGKSDTKKNEDKKEQSSQ
KTADSKQTQPKKEVLAIGDSVMLDIASYLRQSLPHVTIDGKVGRQVSQALQLTSEYASFN
QPNKAVIIELGTNGYFTNSQIESLISSFSKADIYLVNTRVPRQWESKVNESLRQQAESRK
NVTLVDWHAKALQHPEYFTPDGVHLIPEGSKALTSLIVQTMKS
NT seq 1932 nt NT seq  +upstreamnt  +downstreamnt
atgtcagacaagtcactgaatcatcgctatattcccggactggatggacttcgcgccttt
gccgtcctcgcagttatcgcatatcacctgaattttaattgggccgacggcggtttcatt
ggtgttgatatcttttttgttttatcggggtatttaatcacatctattatattgcctgcc
caaggcaatgacatcacccttgatttgcgtgatttttgggtgcgccggatcagacggctt
ctgccggcggcttatctcatgattatcacgacagtcatttgggtcgtattatttaatagc
gagctcctgcataccgtacgcggagatgcggtctcctcacttttttacataagcaactgg
tggtttatctttcataaactttcttatttcgacagcttcggctctccttcgccattaaaa
aacctttggtcgctggcgattgaagaacagttttatatcatatggcctttcctgctgctt
gcaggaatgcacatatgtaaaacacgggcccggcttgcggcagcggtcacattcatcgcg
ttatgctcagcagtcgtgatgagtatgatgtatgtccctggcggagatccgagccgcgtt
tattacgggacggacacccgatcatttgaattgcttatcggctgcgctttagctttagtg
tggccgatgaaacgattatcttccaaacggctgccgagcagcatgaaacacctgcttcac
gggacggagcttgccgcttttgccgcgctgttgctatgcgtcttttacacggatgaatat
gaacccttcctgtacaagggcggcatgcttttgatcagcatcaccgcagcggtccttgtc
gcatgtatatgccatccgagcagttttttgggacatgtcctttcatggaaaccgcttcgc
tggatcggaacgagatcatacggaatctatctttggcattatccggttatcgtgctgagc
acacccgtgcaggaaatcggaaatccggtttattggcattgtgccgtcagaatcggcgcc
actttcattcttgccgaactttcttatcatttcattgagaaaccgatccgcactgcgggc
ttcaggccttttttccgccgcgtgtttttgaaccgctttctggaatggaagacgtcctct
gtcatcagcagaatgtcgctcggcctcattcttgccgccatcctcgtatttgcgggcggg
ctgtcaggaatagccgaggagaaaaaacagccgcaatggacatacgcgcaaagcgggcag
caagaaacagccgcctcttcacacaaaacggctgatcatgataaaccggcaaaagaagat
gacagccagaaaaaatacggcggcgaaaaaacagacgccgcatcagacaaaaacaagaaa
gaatcaacaggcaaatcagatacgaagaaaaacgaagacaaaaaagagcaatcatctcaa
aaaacggctgattcaaaacaaacacagccaaaaaaagaagtgctggccatcggtgactcc
gtgatgctcgacattgcgtcatacctgcggcagtccctccctcatgtcaccatcgacgga
aaggtaggaagacaagtctctcaagcactccagctcacatcggaatacgcgtcatttaat
cagccgaacaaagcggtcatcatcgagttagggacgaacggctatttcacaaacagccag
attgaatcactgatcagctccttttcaaaagctgatatctatcttgtcaatacgcgtgtg
ccgcggcagtgggaaagcaaggtaaacgagtcattgcgccagcaggccgaatcacgcaag
aatgtcacccttgtcgattggcatgcaaaagcattgcagcaccctgaatactttacaccc
gacggcgtacatctcatccctgagggatcaaaagcgctgacatccctcatcgtccaaacc
atgaaatcatga

DBGET integrated database retrieval system