KEGG   Bacillus amyloliquefaciens TA208: BAMTA208_02870Help
Entry
BAMTA208_02870    CDS       T01824                                 

Gene name
rsiV
Definition
(GenBank) anti-sigma factor to SigV
Organism
baz  Bacillus amyloliquefaciens TA208
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF3298 PdaC DUF4179 NrsF Dicistro_VP4 SirA
Motif
Other DBs
NCBI-ProteinID: AEB22761
LinkDB All DBs
Position
complement(579734..580594)
Genome map
AA seq 286 aa AA seqDB search
MEKRLEQLREEYKSVPIPKELDSIVEKALQHKPKKKRIVMWPTSAAVAAAVLFTAVVNIN
PDAAQAMSKIPVIGKVVQAITFVEMKEEKNQSSIDVKTPALSGLSNHELEDSINRHYMKE
SKELYREFMKATSKSKKGHLSIYSDYETVTDTSDLISVRRDIEKTQASSYTQSRYITIDK
KNEAVLTLKSLFKDDRYIKVISQNIKEQMKKQMKEDPNKIYWVEEDDMTEPFKSIHADQN
FYITDQHKLFISFDEYEVAPGYMGVTEFKIPTSVISKLLVGDRYIR
NT seq 861 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaaagattagaacaattaagagaagagtataaaagtgtgcccattcctaaagaa
ctggacagcattgtcgaaaaagcccttcagcacaaaccgaagaaaaaacgaatcgtgatg
tggccgacatccgcggcagtcgctgcggccgtcttatttaccgccgtagtcaatatcaat
ccggatgccgcacaagccatgtctaaaatccccgtcatcggcaaagtcgtccaagccatc
acattcgtggagatgaaagaagaaaagaaccaatcaagcatcgatgtgaaaacgcctgct
ctgtccggcctttccaatcatgaacttgaagacagcatcaaccggcattatatgaaagaa
agcaaagagctctaccgggaatttatgaaggcgacctcaaaaagcaaaaaaggccacctc
agcatctacagcgattatgaaaccgtaactgacacatcggatctgatctcagtccgccgt
gatatcgaaaaaacccaggcttcatcttatacccaaagccgatatatcacgattgataaa
aagaatgaggccgtgcttacgttaaagagcttattcaaagatgaccgttatattaaagtc
atcagccaaaatattaaagaacaaatgaaaaaacagatgaaagaagatccgaataaaata
tattgggtcgaggaagatgatatgacggagcctttcaaatccattcatgccgatcagaat
ttttatattacagatcagcacaaacttttcatctcatttgatgaatacgaagtagcaccc
ggatatatgggcgttacagaatttaaaataccgacctccgtcatctcaaagctgcttgtc
ggagaccgctacatcagataa

DBGET integrated database retrieval system