KEGG   Bacillus amyloliquefaciens TA208: BAMTA208_03330Help
Entry
BAMTA208_03330    CDS       T01824                                 

Gene name
yfmT
Definition
(GenBank) aldehyde dehydrogenase
  KO
K21802  vanillin dehydrogenase [EC:1.2.1.67]
Organism
baz  Bacillus amyloliquefaciens TA208
Pathway
baz00627  Aminobenzoate degradation
baz01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:baz00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    BAMTA208_03330 (yfmT)
Enzymes [BR:baz01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.67  vanillin dehydrogenase
     BAMTA208_03330 (yfmT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: AEB22849
LinkDB All DBs
Position
675386..676843
Genome map
AA seq 485 aa AA seqDB search
MFQYEELNKQFIGGRWRDGSSRNVLEDRNPYTQKVITSFRKATPDDVDAAYRAAALAKQE
WDKVNPFKKRAILEKAVSFIEEHEEAIVYLIMEELGGTRLKAEFEIGLVKNMIKEAATFP
VRMEGKILPSTIDGKENRLYRIPAGVVGVISPFNFPFFLSMKSVAPALGAGNGVVLKPHE
ETPICGGTLIAKIFEAAGVPDGLLNVIVTDIGEIGDSFVEHPVPRIISFTGSTGVGSYIG
QLAVKHFKKPLLELGGNSALIVLEDADLEYAVNAAVFSRFTHQGQICMSANRVLVHTSVY
DKFTELYEAKVSSLKVGDPMDPDTVIGPLINERQAEGLKRSVEKAIEEGAVPVLSGRFSG
TIAEPVILKDVKPDMSIAKEELFGPAVCIMPFETEDEAVSIANATPFGLSGAVHTANVER
GVEFAKRIETGMIHVNDTTINDEPNVAFGGEKQSGLGRLNGEWSLEEFTTLKWISVQHEK
RQFPY
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atgtttcaatatgaagaactaaataagcagtttatcggcggccgatggagggatggaagc
agccggaacgtattggaagacagaaatccttatactcagaaagtcatcacctcattccga
aaagcgacgcctgatgatgtggatgcggcgtaccgtgccgcggctcttgcgaaacaagaa
tgggacaaagtaaacccttttaaaaagcgggccattttggaaaaagcggtatctttcatc
gaagagcatgaagaagcgattgtttacttaatcatggaggaacttggcggaacaagactg
aaggctgagtttgaaatcggacttgttaaaaatatgataaaagaagccgcaacatttccg
gtgcggatggaagggaaaattctcccgtcgacgattgacggaaaagaaaacaggctgtac
agaatacccgccggagtcgtcggggtgatcagcccgtttaatttcccgtttttcctttca
atgaaatctgttgcgccggcactcggcgcggggaacggcgttgtattgaagcctcatgaa
gaaacaccgatctgcggcggcacgcttatcgcgaaaatttttgaagcggccggcgtaccg
gacgggctgctgaacgtcatcgttacggatatcggggagatcggcgacagctttgtcgag
catcccgtgccgcgaattatctcatttacaggttcaacaggggtaggcagctatatcgga
cagcttgcggttaaacactttaaaaaaccgctgttggagcttggcggaaacagcgctctg
atcgtgcttgaggatgctgatctcgaatacgccgtcaatgcggccgtattcagccggttt
acgcatcagggccagatctgcatgtcggcgaaccgcgtgctcgttcacacgtctgtatat
gacaaatttacagagctttacgaagcgaaagtgtcatcgctgaaagtcggcgatccgatg
gaccctgatacggttatcgggcctttaatcaatgagagacaggcggaaggtttaaaacgg
tctgttgaaaaggcgatagaagagggagcggttccggtcttgtccggccgattcagcgga
acgatcgctgaacctgtcatcttaaaagatgtgaagcctgatatgagcatcgcgaaggag
gaactgttcggcccggccgtctgcatcatgccgtttgaaacggaggatgaagctgtcagc
atcgcaaacgcgacaccgttcggtttaagcggagccgtgcatacggcaaacgttgagcgg
ggcgttgagtttgcaaagcggatcgagaccggcatgattcacgtcaatgatacgaccatt
aatgatgaaccgaatgtcgcgttcggcggcgagaagcaatcaggtctcggcaggctgaac
ggcgaatggagccttgaagaattcaccacgctgaaatggatttcggttcagcatgaaaaa
cggcaattcccatattaa

DBGET integrated database retrieval system