KEGG   Bacillus amyloliquefaciens TA208: BAMTA208_14310Help
Entry
BAMTA208_14310    CDS       T01824                                 

Gene name
icd
Definition
(GenBank) isocitrate dehydrogenase
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
baz  Bacillus amyloliquefaciens TA208
Pathway
baz00020  Citrate cycle (TCA cycle)
baz00480  Glutathione metabolism
baz01100  Metabolic pathways
baz01110  Biosynthesis of secondary metabolites
baz01120  Microbial metabolism in diverse environments
baz01130  Biosynthesis of antibiotics
baz01200  Carbon metabolism
baz01210  2-Oxocarboxylic acid metabolism
baz01230  Biosynthesis of amino acids
Module
baz_M00009  Citrate cycle (TCA cycle, Krebs cycle)
baz_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:baz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BAMTA208_14310 (icd)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    BAMTA208_14310 (icd)
Enzymes [BR:baz01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     BAMTA208_14310 (icd)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-ProteinID: AEB25023
LinkDB All DBs
Position
complement(2733171..2734442)
Genome map
AA seq 423 aa AA seqDB search
MSQGEKITVSNGVLNVPNNPIIPFIEGDGTGPDIWNAASKVLEAAVEKAYKGEKKITWKE
VYAGEKAYNKTGEWLPAQTLEDIREYFIAIKGPLTTPVGGGIRSLNVALRQELDLFTCLR
PVRYFTGVPSPVKRPEDTDMVIFRENTEDIYAGIEYAKGSEEVEKLISFLQNEMGVNKIR
FPETSGIGIKPVSEEGTSRLVRAAIEYAIENGRKSVTLVHKGNIMKFTEGAFKNWGYELA
EREYGDKVFTWAEYDRIVEKDGKEAADKAQSEAEAAGKIIVKDSIADIFLQQILTRPSEF
DVVATMNLNGDYISDALAAQVGGIGIAPGANINYETGHAIFEATHGTAPKYAGLDKVNPS
SVILSGVLLLEHLNWNEAADLIIKSMEKTIASKVVTYDFARLMDGATEVKCSEFGEELIK
NMD
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
gtgtcacaaggtgaaaaaattacagtctctaatggagtattaaacgtaccaaataatccg
atcatcccgtttattgaaggcgacggcacaggccctgatatttggaatgccgcttctaaa
gttttggaagctgctgttgaaaaagcatataaaggcgagaaaaaaatcacgtggaaagaa
gtttatgccggtgaaaaggcttataataaaacaggtgaatggctccctgcccaaacgctg
gaagacatcagagagtacttcatcgcgatcaaagggcctctgacgacacctgtcggcggc
ggtatccgttctttgaacgtagcgctgagacaggagcttgatttgtttacgtgtctgcgc
cctgtcagatatttcacaggagtgccttctccggtcaaacgccctgaagatacagatatg
gtcattttccgcgaaaatacagaagatatttacgccggaattgagtatgcgaaaggttct
gaagaagttgaaaagctgatcagcttcctgcaaaatgaaatgggcgttaacaaaatccgt
ttccctgaaacatcaggaatcggaatcaagcctgtttctgaagaaggaacaagccgctta
gtcagagccgccattgagtatgcgatcgaaaacggccgtaaatctgttacacttgtccac
aaaggaaacatcatgaagttcactgaaggggcatttaaaaactggggctacgagcttgct
gaaagagaatacggagataaagtattcacttgggctgaatatgaccgcattgtcgaaaaa
gacgggaaagaagcagctgataaagcgcagagcgaagcggaagcagcagggaaaatcatc
gtcaaagacagcatcgctgatattttccttcagcagatcttaacccgcccgagcgaattc
gacgtcgtggcgacaatgaacttaaacggagactatatctctgatgcgcttgccgctcag
gtaggcggaatcggaatcgcgccgggagcgaacatcaactatgaaacagggcatgcgatt
ttcgaagcgactcacggaacggctcctaaatatgccggccttgacaaggtcaacccgtca
tccgtcatcctttcaggagtgcttcttcttgaacacctgaactggaatgaggctgctgac
ttgatcattaaatctatggaaaaaacgattgcttcaaaagtagtaacgtacgattttgct
agattaatggacggtgcaaccgaagtgaaatgttcagagttcggtgaagagctcatcaaa
aacatggactga

DBGET integrated database retrieval system