KEGG   Bacillus amyloliquefaciens TA208: BAMTA208_16665Help
Entry
BAMTA208_16665    CDS       T01824                                 

Gene name
yusU
Definition
(GenBank) hypothetical protein
Organism
baz  Bacillus amyloliquefaciens TA208
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF2573 DUF5444 DNA_pol_A_exoN
Motif
Other DBs
NCBI-ProteinID: AEB25485
LinkDB All DBs
Position
complement(3157832..3158077)
Genome map
AA seq 81 aa AA seqDB search
MEEKLQQQLDGLLEKYTELLLGETNPDLKEEVRQWILYTHIAKSMPPLVKHWNESYPDAK
EGIKAAIQHIKQLNEDHRKKQ
NT seq 246 nt NT seq  +upstreamnt  +downstreamnt
atggaagagaagctacagcagcagctggacggcctgcttgaaaaatacacagaactattg
cttggagaaacaaatccggatctaaaggaagaagtcaggcagtggattttgtatacacat
atcgcaaaaagcatgcctcccctcgtaaaacattggaatgaatcctacccggacgccaaa
gagggcatcaaagctgcgatacagcacattaaacagctcaatgaagatcacagaaaaaaa
caataa

DBGET integrated database retrieval system