KEGG   Bacillus amyloliquefaciens TA208: BAMTA208_18260Help
Entry
BAMTA208_18260    CDS       T01824                                 

Gene name
cotB
Definition
(GenBank) spore coat protein (outer)
  KO
K06325  spore coat protein B
Organism
baz  Bacillus amyloliquefaciens TA208
Brite
KEGG Orthology (KO) [BR:baz00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99978 Cell growth
    BAMTA208_18260 (cotB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF2642
Motif
Other DBs
NCBI-ProteinID: AEB25804
LinkDB All DBs
Position
complement(3480212..3481087)
Genome map
AA seq 291 aa AA seqDB search
MKRNTNRHRSDDNFLHAMEGKVITVYRGGPESKTGRLADIQSDYIALQVDNKIVYYQWKH
VKSVTENTSETVSPAESAECEKADDFQELIERMANRTVQLNQGGPESKKGKLHETGDDFL
VLETEDDGIVYFNIDHVKSISAEQEDEDEQEDERTEFEMADDFHGIFKRLIHKWVSINRG
GPEAVEGILVDNSDGHYTLVKDKEVLRIHPLHIKSISAGAKGAAKKEENKDENQGEKECA
EEESHEEQHTSSEKSKRSSKEDRSSKRDEDESYSYATVLRTIDYRWKRGRK
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgcaatacgaatcggcatcggtctgatgataactttttgcatgcgatggaagga
aaagtgattactgtctaccgggggggcccggagtccaaaacaggaagattggcagatatt
caatcggattatatcgctcttcaggttgataataaaatcgtttactatcaatggaagcac
gtgaaaagtgtaacggaaaatacgagtgagacagtatcgccggccgagtcggcagaatgc
gaaaaagccgatgatttccaagaactgatcgaacgaatggccaatcgcacggtgcagttg
aaccagggaggcccggaatcgaaaaaaggaaagcttcacgaaacaggggacgattttctt
gtgctggaaacggaagatgatggaattgtatattttaacatcgaccatgtcaaaagcatc
agcgcggaacaagaagatgaagatgagcaagaggatgagcgtacagagtttgaaatggct
gatgattttcacggcatatttaaacgcctgatccacaaatgggtttctatcaaccgcggc
ggtcctgaagccgttgaaggtatacttgtggataattccgacggccactatactcttgtg
aaagataaagaagtgctgcgaatccatccgcttcatatcaagagtatcagcgcgggggca
aaaggagcagctaaaaaagaggagaataaagacgagaatcaaggtgagaaagagtgtgct
gaagaggaatcacatgaggagcagcatacttcctctgaaaaatcgaaaagatcatcaaaa
gaggatcgatcctcaaaacgggatgaagatgaatcttatagttacgccactgtattaaga
acaatagattatcggtggaaacgcggccgtaagtga

DBGET integrated database retrieval system