KEGG   Bdellovibrio bacteriovorus HD100: Bd2518Help
Entry
Bd2518            CDS       T00159                                 

Gene name
ahpF
Definition
(GenBank) alkyl hydroperoxide reductase, subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
bba  Bdellovibrio bacteriovorus HD100
Brite
KEGG Orthology (KO) [BR:bba00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Bd2518 (ahpF)
Enzymes [BR:bba01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     Bd2518 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA HI0933_like FAD_binding_2 Thioredoxin_3 DAO FAD_oxidored Amino_oxidase Thi4 FAD_binding_3 AlaDh_PNT_C NAD_binding_8 Ribosomal_L12_N NAD_binding_9 Spermine_synth K_oxygenase
Motif
Other DBs
NCBI-ProteinID: CAE80318
UniProt: Q6MK91
LinkDB All DBs
Position
2423041..2424606
Genome map
AA seq 521 aa AA seqDB search
MLDSSLLEQLRSVFGSLENTVELVYENSSHEDQKDLLDMLQSVASTSDKITLTQNTSGTS
PMPQFRIDYKGKHTGIVFKGIPGGHEFTSLILAILNTDGKGKLLDSVIADRVRRLNKNIT
IQSYISLTCENCPEVVQALNQIALIHGSLRHEIIDGGYVQDDIKTLGIQGVPSLVANAKM
FHSGRIQLLDLVSKLESTFGVDANAAPSEPVNKNLGHFDVLVIGGGPAGASAAIYTVRKG
LSTAMITEKIGGQVQETKGIENLIGVTYTEGPQLAAQLNQHIASYPVKVLENRRVKKIHT
ESKVKAIELESGEHLTADAIIVTTGAKWRELGVEGEKEYLGRGVAYCPHCDGPFYKGKKV
AVIGGGNSGVEAAIDLAGIVREVVVFEYNDQLKADKILVDKLKSLPNVSIVTSAKTEKVI
GDGNKVQQIQYLDRSLNKEEKMDLDGIFVQIGLVPNSQFLKETVELTKFGEIIVDEKGRT
SAKGIYAAGDVTTTPYKQIVIAMGEGAKAALAAFEDRMYHS
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atgttagactcttctcttcttgaacaactaagatcagtcttcggctctttggaaaacact
gttgagcttgtctatgaaaacagctctcacgaagatcaaaaagatcttttggacatgctt
caaagtgttgccagcacctcggacaaaatcacactgacacaaaatacctccggcacttct
ccgatgcctcagttccgtattgactataaaggcaagcacacgggcatcgtgttcaaaggt
attcccggcggtcacgaattcacttcgttgattctggcgatcctgaacaccgatggcaaa
ggcaagcttttggacagcgtgatcgcggaccgcgttcgtcgtctgaacaaaaacatcacc
attcagtcttacatctctttgacttgtgaaaactgtcctgaagtggtgcaggctctgaat
cagattgctttgattcacggaagccttcgccatgaaatcatcgatggcggctatgttcag
gacgacatcaaaactttgggtattcaaggtgttccaagtctggtggcgaacgcaaaaatg
ttccattccggccgcatccagcttttggatctggtcagcaaactggaatccacatttggt
gtcgacgcgaatgcagcaccatccgaacctgtgaacaaaaacctgggtcactttgacgtc
cttgtgatcggcggcggcccggcaggggcttccgctgcgatctacacggttcgtaaaggt
ctttccacggccatgatcactgaaaaaatcggcggtcaggtgcaggaaaccaaaggcatc
gaaaacctgattggtgtgacttacaccgaaggccctcaactggcagcccagttgaatcag
cacattgccagctatccggtgaaggttcttgaaaaccgtcgcgtgaaaaagatccacacg
gaaagcaaagtcaaagccatcgaactggaaagtggcgaacacctgaccgccgacgcgatc
atcgtcactacgggggcgaaatggcgcgaattgggcgtggaaggtgagaaagaatatctg
ggccgtggcgtggcttactgcccacactgtgatggtccattctataaaggcaaaaaggtc
gctgtgattggcggaggaaactcgggcgtggaagcggcaatcgatctggccggcattgtt
cgcgaagtcgtggtatttgaatacaacgatcagctgaaagccgacaagattctggtggat
aaactaaaatccctgcccaacgtgtccatcgtgaccagcgccaaaactgaaaaagtcatc
ggtgacggcaacaaggttcagcagatccagtatttggatcgttccctcaataaagaggaa
aaaatggacctggatggcatctttgtgcagatcggccttgtgccgaacagccagttcctg
aaagaaaccgtggagctgaccaagttcggcgaaatcatcgtcgatgaaaaaggtcgcact
tcagccaagggcatctacgcagctggcgacgtcaccacgacgccgtacaaacagatcgtg
atcgccatgggtgaaggcgccaaagccgccctggccgcctttgaagaccgtatgtaccat
tcttaa

DBGET integrated database retrieval system