KEGG   Bdellovibrio bacteriovorus HD100: Bd3486Help
Entry
Bd3486            CDS       T00159                                 

Gene name
aroAG
Definition
(GenBank) 3-deoxy-7-phosphoheptalonate synthase/chorismate mutase
  KO
K03856  3-deoxy-7-phosphoheptulonate synthase [EC:2.5.1.54]
Organism
bba  Bdellovibrio bacteriovorus HD100
Pathway
bba00400  Phenylalanine, tyrosine and tryptophan biosynthesis
bba01100  Metabolic pathways
bba01110  Biosynthesis of secondary metabolites
bba01130  Biosynthesis of antibiotics
bba01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bba00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Bd3486 (aroAG)
Enzymes [BR:bba01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.54  3-deoxy-7-phosphoheptulonate synthase
     Bd3486 (aroAG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAHP_synth_1 NeuB DREV
Motif
Other DBs
NCBI-ProteinID: CAE78277
UniProt: Q6MHQ5
LinkDB All DBs
Position
3396736..3397737
Genome map
AA seq 333 aa AA seqDB search
MRIHWLPCRKRAPACKKFVMPSSVMLFCRSTKGPSFFNLIVVKMLKQGREEVRIMETQTM
QTSPSTQIVNVGGFDIGGPNFTVIAGPCSIESQAQFMETASGVKAAGAHLLRGGIWKMRT
SPTAFQGLGANSFDMVRTVCKELNMSLVSEVTDVRQIEEVYDIVECFQVGSRSMQNYELL
KELGRQKKPVLLKRGLAAYIDEWIKASEYVTKMGNQNVILCERGIRTFETATRNTLDLNA
VAYAKKNTHLPVIVDPSHAVGIRALVPDLAYAAAAVGADGIIVEVHPRPAEALSDGMQAL
TLNDFSVMMKKLDRILTAIDRPLHKAHKAEVYV
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atgagaatccattggcttccatgtcgcaagagggcccctgcctgcaaaaagtttgtaatg
ccttcgagcgttatgctattctgccgatccacaaaaggaccctcttttttcaacttaata
gttgtgaaaatgttaaaacaagggcgagaagaagttcgtattatggaaacgcaaactatg
caaacaagtccctcaacccaaattgtcaatgtcggcggttttgatatcgggggacctaat
ttcaccgtgatcgccggcccttgttctatcgaaagccaggcgcagttcatggaaaccgct
tccggcgtaaaagccgctggcgcacacctgcttcgtggtggcatttggaaaatgcgcacc
tcgccgaccgctttccagggtctgggcgcaaactctttcgacatggttcgcactgtttgc
aaagaactgaacatgagccttgtgtccgaagtgactgacgttcgtcaaatcgaagaagtc
tacgatatcgtggaatgcttccaggtcggatcccgcagcatgcaaaactatgagctgctg
aaagaactgggccgccagaaaaagcctgttttgttgaaacgcggtctggctgcttacatc
gacgaatggatcaaagcctctgaatacgtcaccaaaatgggcaaccagaatgtgatcctg
tgtgaacgtggtatccgcactttcgaaactgcgacccgcaacactttggatctgaatgcc
gtggcttacgcgaaaaagaacacacaccttccggtgatcgtggatccttctcacgcggtg
ggcatccgtgctttggttccggatctggcttacgcagcagcggctgtgggcgccgatggt
atcatcgttgaagttcaccctcgtccggcagaagctctgtccgacggtatgcaggcactg
accctgaatgacttctctgtgatgatgaagaagcttgatagaatcctgacggctatcgac
cgtccactgcacaaagcgcacaaggcggaagtttatgtctaa

DBGET integrated database retrieval system