KEGG   Bdellovibrio bacteriovorus 109J: EP01_05615Help
Entry
EP01_05615        CDS       T03079                                 

Definition
(GenBank) amino acid transporter
Organism
bbac  Bdellovibrio bacteriovorus 109J
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_permease_2 AA_permease Aa_trans Spore_permease
Motif
Other DBs
NCBI-ProteinID: AHZ84412
LinkDB All DBs
Position
1184003..1185265
Genome map
AA seq 420 aa AA seqDB search
MKRTLGLVMLVFYATGMILGAGVYSVIGKAAGVAQEGLWLSFILAALAAVLTALSYAELA
TLFPKAGAEYVYMKEIFPQRKILSFLCGCLMIFAAIITASTVSLSFAAYTQDFIKAPEML
VAIVLLGFFTLVNIWGVRESGWMNIVFTLVELSGLVIFIFVGLRQPDFGKVLSAPVSWGV
VTGASLIFFAYLGFESMVNLAEEAKKPDKNIPRAILLSLSLTTVVYVAVSLAALAMMSPG
DLQKSDAVLSAALQKHSPEAARALAGIALFATANTVMIALLGASRISLGMARGRDLPKVF
SKILPQRQSPWLSSLLVFLLALLFLPLKKIEVLASVSSFVTIVVFIIINGAVVYLRRKEP
QRKRPFRVPGAVAGWPVLPMLAAGMALFFLFNFEEQVYYVGVGIVIFVLVVYQALHFRRA
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaagaactctgggccttgtgatgctggttttttatgccacgggcatgatccttggg
gcgggggtgtattcggtgatcggtaaggctgccggggtagctcaagagggattgtggctg
agttttattttggcggcgctggcggctgtgttgacggctctgtcttatgctgaacttgcg
acactttttcccaaggcgggggcggaatatgtttatatgaaagagatctttccgcaaaga
aagatcctttcttttctttgcggttgtctgatgatctttgccgctatcatcaccgcttcg
acggtgtcgctgtcatttgccgcttatactcaggactttatcaaggccccggaaatgctg
gtcgccatagtcttgctgggttttttcacgctggtgaacatctggggggtgcgcgaatcc
ggatggatgaacattgtgttcaccctggttgagctgtctgggttggtgatatttatcttt
gttggcttacggcagcccgatttcggcaaagtcctgtcagctccagtttcctggggcgtg
gtgaccggagcgtctttgattttttttgcttacctggggtttgagagcatggtgaatctg
gctgaagaggcaaaaaaacctgataagaacatcccccgcgcgattttgctcagtctttcg
ctgaccacggtcgtctatgtggcggtcagtctggcggcgctggcgatgatgagccccggg
gatttgcaaaagtcggatgctgtcttaagtgcagccctgcaaaaacattctccagaggcg
gcaagggccttggcagggattgcgttgtttgccacagccaacacggtgatgatcgccttg
ctgggggccagtcgaatcagtctggggatggcgcggggaagggatttgccgaaggttttt
tccaaaatattaccccaacggcaaagtccgtggctttcttcgttgttggtttttttgctg
gcattgttgttcttgccattaaagaaaatcgaagtgcttgccagtgtttcttcgtttgtg
acgatcgtggtttttatcatcatcaacggagcggtggtgtatctgcgccggaaagagcct
cagcgaaagcgcccttttcgggtgccaggggccgtggctggatggccggtgcttccgatg
ctggcggcaggaatggcgttattctttttgtttaactttgaagagcaggtgtactacgtc
ggggtggggattgtgatctttgtgcttgtggtttatcaggcgctgcattttcgccgcgcc
tga

DBGET integrated database retrieval system