KEGG   Bdellovibrio bacteriovorus 109J: EP01_08740Help
Entry
EP01_08740        CDS       T03079                                 

Definition
(GenBank) NADH dehydrogenase
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
bbac  Bdellovibrio bacteriovorus 109J
Brite
KEGG Orthology (KO) [BR:bbac00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    EP01_08740
Enzymes [BR:bbac01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     EP01_08740
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA HI0933_like FAD_binding_2 Thioredoxin_3 DAO FAD_oxidored Amino_oxidase Thi4 FAD_binding_3 AlaDh_PNT_C NAD_binding_8 Ribosomal_L12_N NAD_binding_9 Spermine_synth K_oxygenase
Motif
Other DBs
NCBI-ProteinID: AHZ85025
LinkDB All DBs
Position
1818523..1820088
Genome map
AA seq 521 aa AA seqDB search
MLDSSLLEQLRSVFGSLENTVELVYENSSHEDQKDLLDMLQSVASTSDKITLTQNTSGTS
PMPQFRIDYKGKHTGIVFKGIPGGHEFTSLILAILNTDGKGKLLDSVIADRVRRLNKNIT
IQSYISLTCENCPEVVQALNQIALIHGSLRHEIIDGGYVQDDIKTLGIQGVPSLVANAKM
FHSGRIQLLDLVSKLESTFGVDANAAPSEPVNKNLGHFDVLVIGGGPAGASAAIYTVRKG
LSTAMITEKIGGQVQETKGIENLIGVTYTEGPQLAAQLNQHIASYPVKVLENRRVKKIHT
ESKVKAIELESGEHLTADAIIVTTGAKWRELGVEGEKEYLGRGVAYCPHCDGPFYKGKKV
AVIGGGNSGVEAAIDLAGIVREVVVFEYNDQLKADKILVDKLKSLPNVSIVTSAKTEKVI
GDGNKVQQIQYLDRSLNKEEKMDLDGIFVQIGLVPNSQFLKETVELTKFGEIIVDEKGRT
SAKGIYAAGDVTTTPYKQIVIAMGEGAKAALAAFEDRMYHS
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atgttagactcttctcttcttgaacaactaagatcagtcttcggctctttggaaaacact
gttgagcttgtctatgaaaacagctctcacgaagatcaaaaagatcttttggacatgctt
caaagtgttgccagcacctcggacaaaatcacactgacgcaaaatacctccggcacttct
ccgatgcctcagttccgtattgactataaaggcaagcacacgggcatcgtgttcaaaggt
attcccggcggtcacgaattcacttcgttgattctggcgatcctgaacaccgatggcaaa
ggcaagcttttggacagcgtgatcgcggaccgcgttcgtcgtctgaacaaaaacatcacc
attcagtcttacatctctttgacttgtgaaaactgtcctgaagtggtgcaggctctgaat
cagattgctttgattcacggaagccttcgccatgaaatcatcgatggcggctatgttcag
gacgatatcaaaactttgggtattcaaggtgttccaagtctggtggcgaacgcaaaaatg
ttccattccggccgcatccagcttttggatctggtcagcaaactggaatccacatttggt
gtcgacgcgaatgcagcaccatctgaacctgtgaacaaaaatctgggtcactttgacgtg
cttgttatcggcggcggccctgcgggggcatccgctgcgatctacacggttcgtaaaggt
ctttccacggccatgatcactgaaaaaatcggtggtcaggtgcaggaaaccaaaggcatc
gaaaacctgattggtgtgacttacaccgaaggccctcaactggcagcccagttgaatcag
cacattgccagttatccggtgaaggttcttgaaaaccgtcgcgtgaaaaagatccacacg
gaaagcaaagtcaaagccatcgaactggaaagtggcgaacacctgacagccgacgcgatc
atcgttactacgggggcgaaatggcgcgaattgggcgtggaaggtgaaaaagagtatctg
ggccgtggcgtggcttactgcccacactgtgatggtccattctataaaggcaaaaaggtc
gctgtgattggcggaggaaactcgggcgtggaagcggcaatcgatctggccggcattgtt
cgcgaagtcgtggtatttgaatacaacgatcagctgaaagccgacaagattctggtggat
aaactaaaatccctgcccaacgtgtccatcgtgaccagcgccaaaactgaaaaagtcatc
ggtgacggcaacaaggttcagcagatccagtatttggatcgttccctcaataaagaggaa
aaaatggacctggatggcatctttgtgcagatcggccttgtgccgaacagccagttcctg
aaagaaaccgtggagctgaccaagttcggcgaaatcatcgtcgatgaaaaaggtcgcact
tcagccaagggcatctacgcagctggcgacgtcaccacgacgccgtacaaacagatcgtg
atcgccatgggtgaaggcgccaaagccgccctggccgcctttgaagaccgtatgtaccat
tcttaa

DBGET integrated database retrieval system