KEGG   Bdellovibrio bacteriovorus 109J: EP01_13415Help
Entry
EP01_13415        CDS       T03079                                 

Definition
(GenBank) superoxide dismutase
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
bbac  Bdellovibrio bacteriovorus 109J
Brite
Enzymes [BR:bbac01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     EP01_13415
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-ProteinID: AHZ85927
LinkDB All DBs
Position
complement(2774168..2774737)
Genome map
AA seq 189 aa AA seqDB search
MKRMLLVSLLAVAMTSCMYKSKKAEAPAPAESTPTPTATAAPQKAQAVLKTIKGSKLKGI
IHFTEGDGEMKIETMVEGIKPGPHGFHIHEKGDCSAADFSSAGGHFNPTKGSHAGHDGHG
RHVGDMGNLIADNKSKAITTLVIKGMTMKPGAESIIGKAVVIHADKDDLKSQPAGNSGAR
IACGVIQAL
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagaatgttgcttgtcagtttgttggccgttgcgatgacttcttgtatgtacaaa
tcaaagaaggcggaagctccagcccctgctgaatccactccaaccccgacggcgacagcc
gctcctcaaaaagcccaagcggttctgaagaccatcaaaggttctaaactgaagggcatc
attcacttcaccgaaggtgatggcgaaatgaaaatcgaaaccatggttgaaggcattaag
cctggccctcatggattccatatccatgaaaaaggtgattgttctgctgcggacttttct
tcagccggtggccacttcaatccgaccaaaggatctcacgcaggtcacgacggtcatgga
cgtcatgtgggcgatatggggaacctgattgctgacaataaatccaaggcgatcacaact
ttggttatcaaaggcatgaccatgaagccaggtgctgaaagcattatcggtaaagcggtt
gtgattcacgcggacaaggatgatttgaaatcccaaccggcaggaaactctggtgcgcgt
attgcgtgtggagtgattcaggccctttaa

DBGET integrated database retrieval system