KEGG   Bdellovibrio bacteriovorus 109J: EP01_14855
Entry
EP01_14855        CDS       T03079                                 

Definition
(GenBank) N6-adenine-specific DNA methylase
  KO
K12297  23S rRNA (guanine2445-N2)-methyltransferase / 23S rRNA (guanine2069-N7)-methyltransferase [EC:2.1.1.173 2.1.1.264]
Organism
bbac  Bdellovibrio bacteriovorus 109J
Brite
KEGG Orthology (KO) [BR:bbac00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:bbac03009]
    EP01_14855
Enzymes [BR:bbac01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.173  23S rRNA (guanine2445-N2)-methyltransferase
     EP01_14855
    2.1.1.264  23S rRNA (guanine2069-N7)-methyltransferase
     EP01_14855
Ribosome biogenesis [BR:bbac03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    EP01_14855
SSDB
Motif
Pfam: UPF0020 THUMP Methyltransf_31 MTS
Other DBs
NCBI-ProteinID: AHZ86202
LinkDB
Position
3058287..3059411
AA seq 374 aa
MPQFFASTARGLVEPLELELKELGLKVTDRYIGGVFFESNWEGCYKANLHSRLASRILKP
VLDFTAYQPEELYSQILRHDFTKYIKPTQTISIDASVNESKMRDQRFVAMKVKDAIVDQF
REKFGVRPDVDNTNPDLRIHVRAIKNQFNVAIDTSGDSLFKRGYRKEVGEAPLKENLAAG
LLRLSEWDRQSPLVDFMCGSGTFLIEAAMMSMNIAPGINRKGFGFQNWLNYEEETWEKVI
QEAMDAEKEELDFKFYGFDIDKRVLMNAKDNAKRAGVDEVIEFKKESVATVEPPVEKGLI
IVNPPYGARIGDEDNLRDVYRDLSFTMKHRFKGWDAWILSGNKELIADLKLKSTRKHFVF
NGNIECRFLKYSMF
NT seq 1125 nt   +upstreamnt  +downstreamnt
atgcctcagttttttgcctccacagcccgtggacttgttgaacccctggaactagaatta
aaagagcttggcctgaaggtcacagaccgctacatcggtggtgtgttcttcgaaagcaac
tgggaaggctgctataaagcgaacctgcattcccgtttggccagccgtattttgaagcct
gtcctggatttcacggcttatcagccggaagagctgtacagtcagattcttcgtcacgat
ttcaccaaatacatcaaaccgactcagacgatctccatcgacgccagcgtcaatgaatcc
aaaatgcgtgatcagcgttttgtagcgatgaaagtcaaagacgctatcgtggatcaattc
cgcgaaaagttcggtgtgcgcccggatgtggataacaccaacccggacctgcgtattcac
gtgcgcgcgatcaaaaatcaattcaatgtggccatcgacacgtccggtgacagcttgttc
aagcgtggttatcgcaaagaagtcggcgaagctccattgaaagaaaacctggcagcgggt
ctgctgcgtttgtccgagtgggaccgccaaagcccgctggtggatttcatgtgcggttct
ggaactttcctgattgaggcggcgatgatgtccatgaacatcgctccgggtatcaaccgc
aaaggttttggtttccagaactggttgaactatgaagaagaaacctgggaaaaagtgatc
caggaagccatggatgcagaaaaagaggaacttgatttcaagttctatggctttgatatc
gacaaacgcgttttgatgaacgcgaaagacaacgccaaacgtgccggtgttgatgaagtt
atcgaattcaaaaaagaatctgtggcgacagtggagcctccagttgaaaaaggtctgatc
atcgtgaatccgccgtatggcgcgcgtatcggtgatgaagacaacttgcgtgacgtgtac
cgtgatctgagcttcaccatgaagcacagattcaaaggctgggatgcgtggatcctttcc
ggcaacaaagagctgattgcggatttgaagttgaaatccacacgcaagcactttgtgttc
aatggaaacattgagtgccgcttcctgaaatattctatgttctag

DBGET integrated database retrieval system