KEGG   Burkholderiales bacterium GJ-E10: E1O_08600Help
Entry
E1O_08600         CDS       T03654                                 

Definition
(GenBank) uncharacterized protein
Organism
bbag  Burkholderiales bacterium GJ-E10
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr HDOD GAF GAF_2 APH GAF_3 Pkinase_fungal
Motif
Other DBs
NCBI-ProteinID: BAP87991
UniProt: A0A0A1H153
LinkDB All DBs
Position
complement(939709..942210)
Genome map
AA seq 833 aa AA seqDB search
MGRRSDPARPGPPSAFRRETKTSAPAPPTRIARFEILATLGTGAEGSVYLALDPRLGRRV
AVKTLRLGAAGGLRHDGLASLLDEARIVATLSHPNIVPLHDAGEHVGTPYLVFEYVEGKT
LAALLRTGGPLPVAQAVEIAIALAQGIAYAHERGIIHRDIKPANIMIAPDGVPRLMDFGI
ARRIQADGAASGEIAGTPSYVAPESITRRAFLPAGDQFALGVVLYEMVTGAPPIHGASPR
EIVRRIVEEDFVLPSQRTDGVDARLDGLLMKALAKDPEERFASAAEMAKALHAYLHPDAE
AQTDAATGTLDYLLRRIRHKGDFPAMSATITAVNRAVASDREPISVLCGMILKDFALTTR
LLKLVNASHFTQFGGEISTVSRAIAIVGFNTVRNLAMSLTLFEHLHEHANAAALKDLVIG
AYFSGLLARELAVDADTPNAEQAFVCAMFHRLGKLLATFYLHEEALAVARAMQTHGWDED
RASRHVLGLSYEELGIGVAKAWNLPDDIRASMRAVALPGPMRPEREPERLRLLAGLTNEL
SEIIRTGDESARPQQVRALLERYGPATGIDDRRLNAAVQDATASLMRDADTLGHGVSRSG
FAKKARDWDTAAAQTDPNAASDNGPDTLSRIALTQHLSADAALDAASGADAAAGPGAPAA
PGRRQALLAAGIQDITNSLVSDQPLQDILRIILETMYRAIGFDRVLLFILDAPRQALRCR
YGFGPGADAFVKQKLSLPLQGERDLFYAATVMGVDLCVTDLDAEKVRAHVPAWYRRDVGA
RGLVLLPIAQNKRTVGLIYGDSASAATLHFSAEELGLLKTLRNQAVLAMRQTG
NT seq 2502 nt NT seq  +upstreamnt  +downstreamnt
atgggacggcgatccgatccggcgcgacccggaccgccgtccgcttttcgcagggagacg
aaaacgagcgcgcccgcccccccaacccgcatcgcccgctttgaaatcctcgccacgctc
ggaaccggcgcggaaggatcggtgtatctggcgctcgacccccgccttggccgccgggtc
gcggtgaagacccttcggctgggcgccgccggcggcctgcggcacgacgggcttgcgtcc
ctgctcgacgaagcgcgcatcgtcgccacgctgtcgcatccgaacatcgtcccgctccac
gacgccggtgaacacgttggcacgccctatctcgtcttcgagtacgtcgagggcaagacc
ctcgccgcgctgctgcgcacaggcggcccgctgcccgtcgcccaggcggtggagatcgcc
atcgcgctggcgcagggcatcgcatacgcccatgagcgcggcatcatccatcgcgacatc
aaacccgcgaacatcatgatcgccccggacggcgtgccgcgcctgatggacttcggcatc
gcccgtcgcatccaggcggacggcgccgcctcgggcgagatcgccggcacgccctcctac
gtcgcccccgaatccatcacccggcgggcattcctgccggccggcgaccagttcgcgctc
ggcgtcgtgctctacgagatggtcaccggcgcgccgccgatccacggcgccagcccgcgg
gagatcgtccggcgcatcgtcgaagaagatttcgtcctgccctcgcagcgcaccgacggc
gtcgatgcccgcctcgacggcctgttgatgaaggccctggcgaaggaccccgaggagcgg
ttcgccagcgcggccgagatggccaaggccctgcacgcatacctgcacccggacgccgag
gcgcagaccgacgccgccaccggcaccctggactacctgctgcgccggatccgccacaag
ggcgacttcccggcgatgtcggccacgatcaccgccgtcaatcgcgccgtcgcatcggat
cgggaaccgatctcggtgctgtgcggcatgatcctcaaggacttcgcgctgacgacccgc
ctgctcaaactcgtcaacgcctcgcatttcacgcaattcggcggcgagatcagcaccgtc
tcgcgggccatcgccatcgtcggcttcaacaccgtgcgcaacctcgcgatgtcgctcacg
ctgttcgagcatctccacgaacacgccaacgccgccgcgctcaaggatctcgtcatcggc
gcctacttcagcggcctgctggcccgcgagctggcggtcgacgccgacaccccgaacgcg
gaacaggcgttcgtctgcgcgatgttccaccgtctgggcaagctgctggcgaccttctat
ctgcacgaggaggcgctggcggtggcgcgcgcgatgcagacccacggctgggacgaggac
cgcgcctcccgccacgtgctgggcctgagctacgaagagctcggcatcggcgtcgccaag
gcatggaacctgccggacgacatccgtgccagcatgcgcgccgtcgccctcccggggccg
atgcgaccggagcgggaacccgagcgcctgcgcctgctcgccgggctgaccaacgagctt
tccgagatcatccgcaccggcgacgaatccgcgcgcccccagcaggtccgcgccctgctc
gaacgctacggcccggcgaccggcatcgacgaccgccggctcaacgccgcggtgcaggac
gccaccgcctccctgatgcgcgacgccgacaccctgggccacggcgtttcccgcagcggg
ttcgcgaaaaaggcccgggactgggacacggcggcggcgcagaccgacccgaacgccgcc
tccgacaacgggcccgacaccctgagccggatcgcgctcacccagcacctgagcgccgac
gccgccctggatgctgccagcggcgccgacgccgccgcggggccgggcgcgccggccgca
cccggcaggcgccaggcgctgctcgccgccggcatccaggacatcaccaattcgctggtg
agcgaccagccgctgcaggacatcctgcgcatcatcctggaaacgatgtatcgggcaatc
ggcttcgaccgcgtgctgctgttcatcctcgatgcgccccgccaggcgctgcgctgccgc
tacggcttcgggcccggcgccgacgcgttcgtgaagcagaaactctccctgcccctgcag
ggcgagcgcgacctgttctacgccgccaccgtgatgggcgtggacctctgcgtcaccgac
ctcgacgccgagaaggtgcgcgcccacgttcccgcctggtaccggcgcgacgtcggcgcg
cgcggcctcgtcctgctgccgatcgcccagaacaagcgcacggtgggcctgatctacggc
gacagcgcctcggcggccaccttgcacttcagtgccgaggaactcggcctgctcaagacc
ctgcgcaatcaggccgtgctggcaatgcggcagaccgggtga

DBGET integrated database retrieval system