KEGG   Burkholderiales bacterium GJ-E10: E1O_11080Help
Entry
E1O_11080         CDS       T03654                                 

Definition
(GenBank) glucoamylase
  KO
K01178  glucoamylase [EC:3.2.1.3]
Organism
bbag  Burkholderiales bacterium GJ-E10
Pathway
bbag00500  Starch and sucrose metabolism
bbag01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bbag00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    E1O_11080
Enzymes [BR:bbag01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     E1O_11080
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucodextran_N Glyco_hydro_15
Motif
Other DBs
NCBI-ProteinID: BAP88239
UniProt: A0A0A1H4P4
LinkDB All DBs
Position
1202175..1204448
Genome map
AA seq 757 aa AA seqDB search
MVGTGLGSSRLWFTVAEGILTEVYYPRIDIPQIKDLGFIVADDQGFWVELRRHGDYELHL
PKPGVPAVTIVHHHPRFTFTLQICPSQRCDTLLLSVQLDGDEGLRPYALLAARLGGDAEN
NVAAVDQHNGRTVLWAEQGPFGLALLARQDDGSDAWRRCAVGCLEASDGWQDFSRHGRMS
WQYDRAGPGAVSLMGELPKRATLALGFATSRESAATLAMASLMEDFATAWDAQCRVWDAW
LAPDRFPALPAELGGMLPLSAMVLKVHQDRTYAGAAVASLAVPWGESSQSRGGYHLVWCR
DLVETAGALVAMEAFEDARDVLRYLMATQQEDGHWLQNQWLGGDAFWQGIQLDEAAFPVL
LASALREQDALAGIPVADMVRRALTFIAREGPTTGQDRWEEDPGINTFTLAIAIAALVEG
STFLDGEARQFALLLADSWNAGLDEWTVARGTPLARRLGVSGYYIRSSPADVLVHEGAQA
EHVLIKNRAIDPDLPADEQVGTGFLQLVRYGLRQPDDPFILGSLKAVDQLLKTDTPSGPV
WHRYNGDGYGEHNDGSPFDGTGRGRGWPLLVGERGHYALLAGEDPLPYLKTMAAMTGPGG
MLPEQVWDWHPIPEYRLEPGRPSGSAMPLVWAHSEFIKLCYSRAKGYPVDRPAATWARYQ
GRRPELSHALWGPRFRPRHIRLGGQFSLVLRAPARVHWGNNGWNAVRDDDTRDTGLGVHR
VDLPLAGLKAGDTVQFTFYWPGRDCWEGQDYEVQITD
NT seq 2274 nt NT seq  +upstreamnt  +downstreamnt
atggtgggcaccggtctcggctcttcgcggctctggttcaccgtcgccgaaggcatcctc
accgaggtctattacccgcgtatcgacatcccccagatcaaggacctggggttcatcgtc
gccgacgaccaggggttctgggtggaactgcgccgccacggggactacgagttgcacctg
cccaagccgggtgtgccagccgtgacgatcgttcatcaccacccgcgctttaccttcacg
ctgcagatctgcccttcgcaacggtgcgacacgctgctgctgtccgttcaactggacggg
gacgaaggcctgcgaccctatgcactgctggcggcccggctgggcggcgatgcggaaaac
aacgtcgccgctgtcgaccagcacaatggccgcacggtcctgtgggcggaacagggaccc
ttcgggttggcgctcctggcgaggcaggacgacggttccgacgcttggcggcgttgcgcc
gtgggttgcctcgaagcgagcgacggctggcaggacttttcccgccatgggcgcatgtcc
tggcaatacgaccgcgccgggcccggcgcggtctccctgatgggcgaactgccgaagcgg
gccacgctggccctcggcttcgcgacgagccgcgagtcggcggcgacgctggccatggcc
agcctgatggaggactttgccacggcctgggacgcgcaatgccgggtgtgggacgcctgg
ctggcgccggaccggttcccggcattgcccgctgaactgggcggcatgctgccgctttcc
gccatggtgctcaaggtccaccaggacaggacctatgccggcgccgcagtggcgagtctc
gccgtgccctggggcgagagcagccagagccgcggcggctaccatctggtgtggtgccgc
gacctggtggaaaccgccggggcattggtggccatggaggcgttcgaggatgcccgcgac
gtgttgcgctacctgatggccacccagcaggaagacggccactggctgcagaaccagtgg
ctgggcggcgatgccttctggcagggcatccaactcgacgaggccgccttcccggtcctg
ctggcgtcggcactgcgcgagcaggacgctctggctggaatcccggtcgccgacatggtc
cggcgggccctcaccttcatcgcccgggagggtccgaccaccggacaggatcggtgggag
gaggaccctggcatcaacaccttcacgctcgccatcgccatcgccgcgctggtagagggc
agcacgtttctcgacggcgaggcccggcagttcgccttgctgctggcggacagctggaat
gccgggctcgacgaatggaccgtcgccaggggcactcccctggcgcgtcgcctgggcgtg
agcggctattacatccgtagctcgccggccgacgtattggtgcatgagggtgcccaggcc
gaacacgtattgatcaagaaccgcgccatcgacccggatctgcctgccgacgagcaggtc
ggcactggctttctgcagctggttcgctatggcctgcgccagccggacgaccccttcatt
ctcggcagcctgaaggccgtcgaccaactgctcaagaccgatacccccagcggtccggtc
tggcaccgctacaacggcgacggctacggcgaacacaatgacggcagtccattcgacggt
accggtcgcggccgcggctggccgttgctggtgggcgaacgcggccactatgcgctcctc
gccggcgaagatccgctaccgtatctcaagaccatggcggccatgaccggccccggcggc
atgttgcccgagcaggtctgggactggcaccccattccggagtaccgcctggaacccggc
cgaccaagcggatcggccatgcctctggtctgggcgcacagcgaattcatcaagctttgc
tacagccgcgcgaagggctatccggtagaccgcccggcagccacctgggcacgctatcag
ggaaggcggcctgagctttcccatgccctttgggggccgcgttttcgcccccgccatatc
cgcctgggcggccagttcagcctggtgctccgcgccccggcccgcgttcactggggcaac
aacggctggaacgccgtgcgggacgatgacacccgggacaccgggctcggcgtgcaccgg
gtcgatctaccgctggccggtctcaaggccggcgacaccgttcaattcaccttctactgg
ccgggccgggattgctgggagggccaggactacgaagtgcagataaccgactag

DBGET integrated database retrieval system