KEGG   Burkholderiales bacterium GJ-E10: E1O_14120Help
Entry
E1O_14120         CDS       T03654                                 

Definition
(GenBank) ribulose-1,5-bisphosphate carboxylase/oxygenase large subunit
  KO
K01601  ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
bbag  Burkholderiales bacterium GJ-E10
Pathway
bbag00630  Glyoxylate and dicarboxylate metabolism
bbag01100  Metabolic pathways
bbag01120  Microbial metabolism in diverse environments
bbag01200  Carbon metabolism
Module
bbag_M00165  Reductive pentose phosphate cycle (Calvin cycle)
bbag_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Brite
KEGG Orthology (KO) [BR:bbag00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    E1O_14120
Enzymes [BR:bbag01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     E1O_14120
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_large RuBisCO_large_N
Motif
Other DBs
NCBI-ProteinID: BAP88543
UniProt: A0A0A1H2J0
LinkDB All DBs
Position
complement(1536724..1538145)
Genome map
AA seq 473 aa AA seqDB search
MAVKKYEAGVKEYRHTYWQPDYVPLDSDILACFKITPQPGVDREEAAAAVAAESSTGTWT
TVWTDLLTDLDYYKGRAYSIEDVPGDDSCFYAFIAYPIDLFEESSVVNVFTSLVGNVFGF
KAVRALRLEDVRFPLHYVKTCNGPPSGIQVERDKLNKYGRPLLGCTIKPKLGLSAKNYGR
AVYECLRGGLDFTKDDENVNSQPFMRWRDRFLFVADAIHNAEAQTGERKGHYLNVTAPSP
EEMYERAEFAKELKMPIVMHDFLTGGFCANTGLARWCRKNGMLLHIHRAMHAVIDRNPHH
GIHFRVLAKALRLSGGDHLHTGTVVGKLEGDRAATLGWIDLLRESFIPEDRSRGIFFDQD
WGSMPGVFAVASGGIHVWHMPALVTIFGDDSVLQFGGGTLGHPWGNAAGAAANRVALEAC
VEARNRGRQLETEGKEILTNAARHSPELKIAMETWKEIKFEFDTVDKLDVQNR
NT seq 1422 nt NT seq  +upstreamnt  +downstreamnt
atggcagtgaagaaatacgaagccggcgtgaaggagtaccggcacacctactggcagccg
gattacgtccccctggactcggacatcctggcctgcttcaagatcaccccgcagcccggc
gtcgaccgggaagaggccgccgccgcggttgcggccgagtcctccaccggcacctggacc
acggtctggaccgatctgctgaccgacctcgactactacaaggggcgcgcctactcgatc
gaagacgttcccggcgacgacagctgcttctacgccttcatcgcgtacccgatcgatctc
ttcgaagagtcgtcggtggtcaacgtattcacctctctggtcggcaacgtgttcggattc
aaggccgtgcgggccctgcgtctcgaggacgtccgcttcccgctgcactacgtcaagacc
tgcaacggccccccgagcgggatccaggtcgagcgcgacaagctcaacaagtacggccgt
cctcttctgggctgcacgatcaagcccaagctgggcctgtcggcgaagaactacggccgg
gcggtgtacgagtgcctgcgcggcggtctcgacttcacgaaggacgacgagaatgtcaac
agccagccgttcatgcgctggcgcgaccggttccttttcgttgccgacgccatccacaac
gcggaggcgcagaccggcgagcgcaagggccactacctgaacgtcaccgcgccgtcgccc
gaagagatgtacgagcgtgccgagttcgccaaggaactcaagatgccgatcgtcatgcac
gacttcctgaccggcggcttctgcgccaacacgggtctggcgcgctggtgtcgcaagaac
ggcatgctgctgcacatccaccgcgcgatgcacgccgtgatcgatcgcaacccccatcac
ggcatccacttccgcgtgctggccaaggcgctgcgcctgtcgggcggcgaccacctgcac
accggcaccgtcgtcggcaagctcgagggcgatcgcgcggccaccttgggctggatcgat
cttctgcgcgaatcgttcatccccgaggaccgctcgcgcggcatcttcttcgaccaggac
tggggctcgatgccgggcgtgttcgcggtcgcctcgggcggcatccatgtctggcacatg
cctgcgctggtgacgatcttcggcgacgactcggtcctgcagttcggcggcggcacgctc
ggccacccgtggggcaatgcggccggtgccgcggccaaccgggtcgcgctcgaggcctgc
gtcgaagcgcgcaaccgcggccgtcaactggagaccgaaggcaaggaaatcctgaccaac
gccgcccgccacagtcccgaactgaagatcgccatggagacgtggaaggagatcaagttc
gagttcgataccgtggacaagctggacgtgcagaaccgctaa

DBGET integrated database retrieval system