KEGG   Burkholderiales bacterium GJ-E10: E1O_23300Help
Entry
E1O_23300         CDS       T03654                                 

Definition
(GenBank) phosphoribosyl-ATP pyrophosphatase
  KO
K01523  phosphoribosyl-ATP pyrophosphohydrolase [EC:3.6.1.31]
Organism
bbag  Burkholderiales bacterium GJ-E10
Pathway
bbag00340  Histidine metabolism
bbag01100  Metabolic pathways
bbag01110  Biosynthesis of secondary metabolites
bbag01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bbag00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00340 Histidine metabolism
    E1O_23300
Enzymes [BR:bbag01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.31  phosphoribosyl-ATP diphosphatase
     E1O_23300
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PRA-PH MazG SMN
Motif
Other DBs
NCBI-ProteinID: BAP89461
UniProt: A0A0A1H565
LinkDB All DBs
Position
complement(2472307..2472705)
Genome map
AA seq 132 aa AA seqDB search
MSADRNTLAELADVIDARHGSDPERSYVARLLSKAPDAILKKIGEEATETVMAAKDGDPA
RIVSETADLWFHCLVMLSHYGLRPEQVLAELARRAGTSGLEEKALRKAREREAESGGAGG
VATTASRSGEGR
NT seq 399 nt NT seq  +upstreamnt  +downstreamnt
atgagcgcggaccgaaacacgctcgcggaactcgccgacgtgatcgatgcacgacacggc
agcgaccccgagcgctcgtacgtcgcgcggctgctgtcgaaggcgcctgacgcgatcctg
aaaaaaatcggcgaggaggccaccgaaaccgtcatggcggccaaggacggcgatcccgcg
cggatcgtttccgaaaccgccgatttgtggtttcattgcctcgtgatgctgtcgcattac
ggcctgcggccggaacaggtgcttgccgaattggcgcgccgggccggaacctccggcctg
gaagaaaaggcgttgcgcaaggcgcgggaacgcgaggcggaatcgggtggcgcgggcggc
gtggcgacgacggcaagccgatcgggagaggggcggtga

DBGET integrated database retrieval system