KEGG   Burkholderiales bacterium GJ-E10: E1O_23630Help
Entry
E1O_23630         CDS       T03654                                 

Definition
(GenBank) D-alanine-D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
bbag  Burkholderiales bacterium GJ-E10
Pathway
bbag00473  D-Alanine metabolism
bbag00550  Peptidoglycan biosynthesis
bbag01100  Metabolic pathways
bbag01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:bbag00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    E1O_23630
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    E1O_23630
 09160 Human Diseases
  09168 Drug resistance
   01502 Vancomycin resistance
    E1O_23630
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:bbag01011]
    E1O_23630
Enzymes [BR:bbag01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     E1O_23630
Peptidoglycan biosynthesis and degradation proteins [BR:bbag01011]
 Precursor biosynthesis
  Amino acid ligase
   E1O_23630
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATPgrasp_Ter CPSase_L_D2
Motif
Other DBs
NCBI-ProteinID: BAP89494
UniProt: A0A0A1H887
LinkDB All DBs
Position
complement(2507549..2508577)
Genome map
AA seq 342 aa AA seqDB search
MTMGTKGSTTATTAMPAQGHLAPRTFGRVGVLYGGRSSERDVSIRSGAAVLRALREAGVD
AHEFDPAMHTLAELEAARFDRVFCILHGRYGEDGAIQGVLETLRVPYTGSGIRASAVAMD
KPTTKEIWTAAGLPTPAWLQLARDDDVGAAFARCGAAEFAPGLVVKPAREGSSFGAGKVG
AGDRPAFEAALREAWKYDAQALIEERIIGRELTCALLGEGADTTALPLVEICAPDANYDY
QNKYFGDRTEYRCPAPLDPALAQRIQDLCVRAYRAIGARGWGRIDVMLRDEADGAKPYLL
ELNTAPGMTDHSLVPMAARAAGIDFPDLVLRILAGARLELGA
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgaccatggggacgaagggatccacgaccgcgacgaccgccatgccggcacaggggcac
ctggcgccgcgcacgttcggccgcgtcggcgtgctgtacggcggccgctcgtccgagcgg
gatgtgtcgatccgttcgggagccgcggtgctgcgggcgctgcgtgaggccggggtggac
gcgcacgaattcgaccccgcgatgcatacgctcgcagaactcgaggcggcgcggttcgac
cgcgtgttctgcatcctccacggccggtatggcgaggacggcgcgatccagggcgtgctc
gaaaccttgcgggtgccctacacggggagcggcattcgcgcttccgcggtggcgatggac
aagccgaccaccaaggagatctggaccgccgctggattgccgactccggcctggctgcag
ctggctcgcgacgacgacgtcggcgcggcatttgcgcgttgcggcgcggcggagttcgct
ccgggcctcgtggtgaagcctgcgcgggagggatcgagcttcggcgccggcaaggtgggg
gcgggcgatcgcccggcgttcgaggcggcgctgcgcgaggcctggaaatacgatgcgcag
gcgttgatcgaggagcggatcatcggccgcgaactgacctgtgcgctgctcggcgaaggt
gccgacacgacggcgctgccgttggtggagatctgcgcacccgacgcaaactacgactat
caaaacaagtatttcggcgaccggaccgagtaccggtgcccggcgccgctcgatccggcg
ctggcgcagcggatccaggatttgtgcgtgcgggcctatcgcgcgatcggcgcgcgcggc
tggggccgcatcgatgtgatgctgcgcgacgaagccgacggggcgaagccctatctcctc
gagctcaacaccgcgccgggaatgaccgaccactcgctcgtgccgatggcggcgcgcgcc
gccggcatcgacttccccgacctcgttcttcgcatcctcgcgggcgcgcggctggagctg
ggggcatga

DBGET integrated database retrieval system