KEGG   Burkholderiales bacterium GJ-E10: E1O_29720Help
Entry
E1O_29720         CDS       T03654                                 

Definition
(GenBank) glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
bbag  Burkholderiales bacterium GJ-E10
Pathway
bbag00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:bbag00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    E1O_29720
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bbag02000]
    E1O_29720
Enzymes [BR:bbag01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     E1O_29720
Transporters [BR:bbag02000]
 Other Transporters
  Pores ion channels [TC:1]
   E1O_29720
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_C GST_C_2 GST_C_3 GST_N_3 GST_N_2 GST_N GST_C_6
Motif
Other DBs
NCBI-ProteinID: BAP90103
UniProt: A0A0A1H6Y0
LinkDB All DBs
Position
complement(3162572..3163180)
Genome map
AA seq 202 aa AA seqDB search
MKLYYSPGACSLSPHIVLREAGLPAQLVRVDLRSGMTQDGADFRAINGKGYVPALELPDG
TLLTEGPAIVQYLADQSPDSGLAPANGTIERYRVQEWLNFISTELHKQFSPLFDPASDSS
QKTRQRERIGRRLDWVAARLGEGDYLMGSRFTIADAYLFVVLSWARHVGIDLGRWPALAA
YQDRVGRRPQVQEALRAEGLAQ
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atgaaactctattactcccccggcgcctgttccctgtccccgcacatcgtcctccgggag
gccggtcttcccgcgcaactcgtccgagtcgacctgcggtccgggatgacccaggatggc
gcggatttccgcgccatcaacggcaagggctacgttcccgctctcgaattgcccgacggg
acattgctgacggaagggcccgcgatcgtgcaatacctggcggaccaaagcccggacagc
ggattggcgccggccaacggaacgatcgaacgctatcgcgtgcaggaatggctgaacttc
atctcgacggaactgcataagcagttttcgccgctcttcgacccggccagcgacagcagc
cagaaaacccggcaacgggaacgtatcggacggcgcctggattgggtcgctgcgagactg
ggcgagggcgactacttgatgggaagccggtttacgattgccgacgcgtatctgtttgtc
gtgctgtcctgggctcggcacgttggaatcgatttgggacggtggccggctctggctgca
taccaggaccgggtgggccgacgaccccaggtgcaggaggcgttgcgcgcggaaggtctc
gcccagtag

DBGET integrated database retrieval system