KEGG   Burkholderiales bacterium GJ-E10: E1O_30290Help
Entry
E1O_30290         CDS       T03654                                 

Definition
(GenBank) penicillin-binding protein, 1A family
  KO
K05366  penicillin-binding protein 1A [EC:2.4.1.129 3.4.16.4]
Organism
bbag  Burkholderiales bacterium GJ-E10
Pathway
bbag00550  Peptidoglycan biosynthesis
bbag01100  Metabolic pathways
bbag01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:bbag00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    E1O_30290
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    E1O_30290
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:bbag01003]
    E1O_30290
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:bbag01011]
    E1O_30290
Enzymes [BR:bbag01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.129  peptidoglycan glycosyltransferase
     E1O_30290
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     E1O_30290
Glycosyltransferases [BR:bbag01003]
 Polysaccharide
  Bacterial polysaccharide
   E1O_30290
Peptidoglycan biosynthesis and degradation proteins [BR:bbag01011]
 Peptidoglycan biosynthesis and degradation
  Glycosyltransferase/DD-Transpeptidase (Class A PBP)
   E1O_30290
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transgly Transpeptidase PCB_OB MDMPI_C
Motif
Other DBs
NCBI-ProteinID: BAP90160
UniProt: A0A0A1H9P4
LinkDB All DBs
Position
complement(3212944..3215298)
Genome map
AA seq 784 aa AA seqDB search
MRLIGFLVVVIGAGAACAAFLGAMLFALAYHRLPSTEALTNYRPKLPLRVWSADGVLLGE
FGEERRRFVALRDVPKPLKEAILAAEDTNFYQHGGFDAAGILRAMVADIVSGHRVQGAST
ITMQVARNFFLSSERTYLRKIYEIAMAVKIESELSKDRILEIYVNQIYLGQRAYGFAAAA
QTYFGKPLSKLSLAECAMLAELPKAPSTGNPQVNPKFARARQHYVLGRMLADGYIDRKAY
DAAMAQPISVRGSEAAFANTTASGVHAGVHAEYAAELVRQMVANVYHEDAYEYGLNVITT
IDSRAQALAYAALRRQVLAYDRLRGYRGPERHVDLDAPADDKARKRYIAAALAAAPEVPG
FPAAVVLAAGPRAVRARLADGSTVEIRGGGLKFVAAALRRHAPRAHRITPGSIIRLARGA
NDDWTITQLPAVQAAFVAADARSGAVRALVGGFDFRLNKFDHVTQAWRQPGSSIKPFLFS
AAIEKGVMTTTLVNDAPLIIPAAETGSTPWQPKDYEPDFKGPMTLREGLAESRNLVSIRV
LQAIGPDYAQKYIERFGFDPGRNPAYLTMALGAGAVTPWQELGAYAIIANGGYAVHPYLI
QRVTDGTGHVLMQAHPELAEQNAPRVYDARTDYVMNSLLQDVTRYGTAKRASVLHRDDIA
GKTGTTNLSHDAWFSGYGGGTVAVSWVGFDQPKPLGAHETGGDLALPIWIDYMAGMLKGV
PETVRPMPPGVVQVNGDVYLQEFQPGNGGIASIGVDDSSPAPGSVPAMTGANPAMSQWLQ
YERH
NT seq 2355 nt NT seq  +upstreamnt  +downstreamnt
atgcgcctgatcggctttctcgtcgtcgtcatcggagccggcgccgcgtgcgcggcgttc
ctcggcgcgatgctgtttgcactcgcctaccaccgcctcccgtccaccgaggcgctgacc
aattaccggcccaagctgccgctgcgcgtctggagcgccgacggcgtcctgctgggcgag
ttcggcgaagagcggcgccggttcgtcgccctccgcgacgtcccgaagccgctcaaggaa
gccattcttgcggcggaagacacgaatttctatcagcatggcggcttcgatgcggccggc
atcctgcgggcgatggtcgcggacatcgtgtccggccatcgggtccagggcgccagcacg
atcacgatgcaggtggcgcgcaacttcttcctgagttccgagcggacgtacctgcgcaag
atttatgaaatcgcgatggcggtcaagatcgaatcggaactgtccaaggaccgcatcctc
gagatctacgtcaaccagatctacctcggccagcgggcctacggattcgccgccgccgcg
cagacgtatttcggcaagccgctgtcgaagctttcgctggcggagtgcgccatgcttgcc
gaactgcccaaggcgcccagcaccggcaatccgcaggtcaatccgaaattcgcgcgcgcg
cgccagcactacgtgctcgggcgcatgctggcggacggctacatcgaccggaaggcatac
gatgccgcgatggcacagccgatctccgtccgcggtagcgaagccgccttcgccaatacc
accgcttccggagtccatgcgggggttcatgcagagtacgcggcggaactggtccggcag
atggtcgccaacgtctatcacgaggacgcctacgagtacgggttgaacgtcatcacgacg
atcgacagccgtgcccaggcactggcctatgccgccttgcgccggcaggtgctggcctac
gaccggctgcgcggctaccgcgggccggaacgccacgtcgacctcgacgccccagccgac
gacaaggcgcgcaagcggtacatcgccgcggccctcgccgcggcgcccgaggttcccggc
tttccggccgccgtggtgctcgccgccgggccgcgcgccgtgcgcgcccgcctagccgac
ggctcgaccgtcgagatccggggcggcggcctgaagttcgtggccgcggcgctccggcgc
catgcgccgcgcgcgcaccggatcacgccgggttcgatcatccggctcgcccgcggcgcc
aacgacgactggacgatcacgcagctgccggcggtgcaggcggcattcgtcgccgccgat
gcccggagcggcgcggtgcgcgcgctcgtcggcggcttcgattttcggctgaacaagttc
gatcatgtgacgcaggcctggcggcaaccgggttccagcatcaagccgttcctcttttcc
gccgcgatcgaaaagggcgtgatgaccacgaccctcgtcaacgatgcgccgctcatcatc
ccggcagcggaaaccggcagcacgccgtggcaacccaaagactacgagcccgatttcaag
ggaccgatgacgttgcgggaaggactggcggaatcgcgcaacctcgtgtcgatccgtgtg
ctgcaggccatcggcccggattacgcccagaagtacatcgagcgcttcggcttcgacccc
ggcagaaaccccgcgtacctgaccatggcgctcggggccggggcggtcacgccctggcag
gagctgggcgcgtacgcgatcatcgccaacggcggatacgccgtgcatccctacctcatc
cagcgggtcaccgacggaaccggccacgtcctcatgcaggcgcatccggaactcgcggaa
cagaatgcgccgcgggtgtacgacgcccgaaccgactacgtgatgaacagcctgctgcag
gacgtcacgcggtacggcaccgccaagcgcgcgtcggtgctccatcgcgacgacatcgcc
ggaaaaaccgggaccacgaacctgtcgcatgacgcgtggttctcgggctacggcggcggc
acggtggccgtgtcctgggtgggcttcgatcaaccgaagccgctcggcgcgcacgaaacg
ggcggcgacctcgccctgccgatctggatcgactacatggccgggatgctgaagggggtg
ccggaaaccgtgcgtccgatgccgccgggcgtggtccaggtcaacggcgatgtctacctg
caggaatttcaacccggcaacggcggcatcgccagcatcggcgtcgacgactcgtctccg
gcgccgggctccgtccccgcgatgaccggggccaacccggccatgtcgcaatggttgcaa
tacgagcggcactga

DBGET integrated database retrieval system