KEGG   Bdellovibrio bacteriovorus Tiberius: Bdt_1650Help
Entry
Bdt_1650          CDS       T02356                                 

Gene name
pstB
Definition
(GenBank) phosphate transport system ATP-binding protein
  KO
K02036  phosphate transport system ATP-binding protein [EC:7.3.2.1]
Organism
bbat  Bdellovibrio bacteriovorus Tiberius
Pathway
bbat02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:bbat00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    Bdt_1650 (pstB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bbat02000]
    Bdt_1650 (pstB)
Enzymes [BR:bbat01000]
 7. Translocases
  7.3  Catalysing the translocation of inorganic anions and their chelates
   7.3.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.3.2.1  ABC-type phosphate transporter
     Bdt_1650 (pstB)
Transporters [BR:bbat02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Phosphate transporter
    Bdt_1650 (pstB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 AAA_22 SMC_N AAA_15 AAA_16 TniB NB-ARC AAA_23 RsgA_GTPase Rad17 AAA_30 AAA_29 ABC_ATPase AAA_11 AAA NACHT SbcCD_C PhoH AAA_14 AAA_5 AAA_33 PduV-EutP AAA_25 AAA_24 ATPase_2 AAA_19 AAA_28 G-alpha cobW
Motif
Other DBs
NCBI-ProteinID: AFY01345
UniProt: K7YX92
LinkDB All DBs
Position
1752135..1752902
Genome map
AA seq 255 aa AA seqDB search
MQLNLRAEVKNLVFSYGDKKVLNGITLPIYENRVTALIGPSGCGKTTLLRCFNRMHDLYA
NAQYQGEILLYPNQSNILGKDIDPMEVRMRIGMVFQKPNPFPKSIYDNVAYGLTVRGVKK
KSFIEEQVEKSLQQASLWNEVKDRLHSSATALSGGQQQRLCIARALATEPEILLLDEPTS
ALDPISTRHIEELIQELRKDVTIAIVTHSLHQAARVSDFTAFMYLGDLIEFGASDQIFTN
PKDQRTENYITGRFG
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgcagttgaatttgcgcgctgaagttaaaaatctggttttctcttacggtgataaaaaa
gttctgaacggcatcacgttgccgatttatgaaaaccgcgtcactgctttgattggtcct
tccggttgcggtaagaccacgctgcttcgttgtttcaaccgcatgcatgatctttacgcc
aatgcccagtatcagggcgagattctgctttatccaaatcaaagcaacatcctgggtaaa
gacatcgacccaatggaagtgcgcatgcgtatcggaatggttttccaaaaaccaaatcca
ttcccaaaaagcatctatgacaacgtcgcttacgggctgacggttcgcggggtcaaaaag
aaaagcttcatcgaagaacaagttgaaaagtccctgcagcaggcgagcctttggaacgaa
gtcaaagatcgtttgcactcttcagcgaccgcgctttccggcggccagcagcagcgtctg
tgcatcgcccgcgccctggcgaccgaacctgaaatcctgctgctggatgaacctacatca
gccctggatccaatctccactcgtcacatcgaagagctgattcaagagcttcgtaaagac
gtcacaatcgcgatcgtcacccacagcttgcaccaggcagcccgtgtgtcggacttcacc
gcattcatgtatctgggcgacctgatcgaattcggcgccagtgatcagatcttcaccaac
ccaaaagatcaaagaacagaaaactacatcacaggccgcttcggctaa

DBGET integrated database retrieval system